Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0NLS9

Protein Details
Accession A0A0L0NLS9    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
91-125APPPTIKSRRDLPKKTKKTYKKKANIVPVKKPNAGHydrophilic
NLS Segment(s)
PositionSequence
97-133KSRRDLPKKTKKTYKKKANIVPVKKPNAGERKAFRKR
Subcellular Location(s) mito 11, nucl 8, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR019368  Ribosomal_S23/S29_mit  
IPR017082  Ribosomal_S23_mit_fun  
Gene Ontology GO:0005763  C:mitochondrial small ribosomal subunit  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF10236  DAP3  
Amino Acid Sequences DFCPGRPYTSSSSCRQAEQPQAAQLASTRRYTNLVAVSYEHVFDTPFGRAIMASANAFRSLMRPSIHVAPRIQPIMLAMAAFSTSSALAAAPPPTIKSRRDLPKKTKKTYKKKANIVPVKKPNAGERKAFRKRIQLSNNSALPVPGLGELGFETMASGESKGKIFAIPDQVVDQLRALEAFKTTQTWSLFRRPHILVRGETVELMSRLEGSKEKGEALKCVLTGSRLSGKSLAMLQAMSHALLNGWVVIHIPEGQDLTNGNTEYSPIPDTEPMQFAQPVYCLKLMQNIYKANKAVLEKLQLHKDWSKITNLKQGATLADLALSAKESEYAWPTLNALWTELIQPGRPPVLFGLDGLAHINKISEYRDPSFNKVHAHYLTLVGMFVDALSGKTKLPNGGAVIAATSANNSPRHPSQELALSQLEAGQAGGEMPTPDPYERKYDGRVYDALKNSYVLRLEGVSKDEGRVLMEYWGASGLVRSELNTRTVSEKWALGGHGIVGEMERVSLMTMRM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.53
3 0.53
4 0.53
5 0.55
6 0.54
7 0.5
8 0.51
9 0.47
10 0.42
11 0.37
12 0.35
13 0.31
14 0.3
15 0.27
16 0.26
17 0.3
18 0.31
19 0.34
20 0.31
21 0.3
22 0.27
23 0.28
24 0.3
25 0.27
26 0.26
27 0.21
28 0.15
29 0.14
30 0.14
31 0.14
32 0.13
33 0.13
34 0.13
35 0.13
36 0.12
37 0.12
38 0.15
39 0.14
40 0.13
41 0.14
42 0.15
43 0.15
44 0.15
45 0.15
46 0.14
47 0.15
48 0.18
49 0.18
50 0.18
51 0.21
52 0.31
53 0.35
54 0.37
55 0.37
56 0.38
57 0.42
58 0.42
59 0.38
60 0.29
61 0.25
62 0.23
63 0.21
64 0.15
65 0.09
66 0.08
67 0.08
68 0.08
69 0.07
70 0.05
71 0.04
72 0.05
73 0.05
74 0.05
75 0.05
76 0.07
77 0.08
78 0.09
79 0.09
80 0.12
81 0.17
82 0.22
83 0.24
84 0.27
85 0.35
86 0.45
87 0.55
88 0.63
89 0.69
90 0.75
91 0.84
92 0.89
93 0.9
94 0.91
95 0.91
96 0.92
97 0.92
98 0.91
99 0.91
100 0.9
101 0.9
102 0.9
103 0.87
104 0.86
105 0.84
106 0.81
107 0.74
108 0.67
109 0.65
110 0.65
111 0.6
112 0.57
113 0.55
114 0.6
115 0.66
116 0.72
117 0.67
118 0.67
119 0.7
120 0.72
121 0.74
122 0.72
123 0.7
124 0.7
125 0.67
126 0.58
127 0.51
128 0.41
129 0.32
130 0.23
131 0.15
132 0.08
133 0.07
134 0.05
135 0.06
136 0.06
137 0.06
138 0.06
139 0.05
140 0.05
141 0.04
142 0.05
143 0.05
144 0.06
145 0.07
146 0.09
147 0.09
148 0.1
149 0.1
150 0.1
151 0.1
152 0.13
153 0.19
154 0.18
155 0.18
156 0.19
157 0.2
158 0.2
159 0.2
160 0.16
161 0.09
162 0.09
163 0.09
164 0.08
165 0.07
166 0.07
167 0.08
168 0.08
169 0.09
170 0.1
171 0.15
172 0.16
173 0.19
174 0.22
175 0.3
176 0.33
177 0.33
178 0.38
179 0.35
180 0.39
181 0.42
182 0.41
183 0.33
184 0.33
185 0.33
186 0.28
187 0.25
188 0.2
189 0.15
190 0.12
191 0.11
192 0.08
193 0.06
194 0.06
195 0.08
196 0.09
197 0.1
198 0.12
199 0.12
200 0.14
201 0.17
202 0.17
203 0.17
204 0.18
205 0.17
206 0.15
207 0.15
208 0.14
209 0.12
210 0.11
211 0.12
212 0.16
213 0.15
214 0.16
215 0.17
216 0.16
217 0.16
218 0.17
219 0.15
220 0.09
221 0.09
222 0.08
223 0.08
224 0.08
225 0.07
226 0.06
227 0.05
228 0.05
229 0.05
230 0.05
231 0.03
232 0.03
233 0.03
234 0.03
235 0.03
236 0.04
237 0.04
238 0.05
239 0.05
240 0.05
241 0.05
242 0.06
243 0.06
244 0.07
245 0.09
246 0.09
247 0.08
248 0.08
249 0.09
250 0.09
251 0.1
252 0.09
253 0.08
254 0.08
255 0.09
256 0.11
257 0.11
258 0.12
259 0.11
260 0.11
261 0.11
262 0.11
263 0.1
264 0.1
265 0.1
266 0.1
267 0.11
268 0.1
269 0.1
270 0.16
271 0.18
272 0.19
273 0.23
274 0.27
275 0.28
276 0.31
277 0.31
278 0.25
279 0.27
280 0.25
281 0.23
282 0.2
283 0.23
284 0.24
285 0.27
286 0.31
287 0.28
288 0.31
289 0.3
290 0.3
291 0.29
292 0.27
293 0.31
294 0.31
295 0.34
296 0.39
297 0.37
298 0.36
299 0.33
300 0.31
301 0.25
302 0.21
303 0.18
304 0.1
305 0.08
306 0.08
307 0.07
308 0.06
309 0.06
310 0.05
311 0.04
312 0.05
313 0.05
314 0.07
315 0.09
316 0.11
317 0.11
318 0.11
319 0.12
320 0.12
321 0.14
322 0.13
323 0.11
324 0.1
325 0.1
326 0.11
327 0.12
328 0.12
329 0.11
330 0.11
331 0.12
332 0.14
333 0.13
334 0.12
335 0.11
336 0.13
337 0.13
338 0.13
339 0.13
340 0.11
341 0.11
342 0.12
343 0.11
344 0.07
345 0.07
346 0.08
347 0.06
348 0.07
349 0.09
350 0.12
351 0.17
352 0.2
353 0.28
354 0.31
355 0.36
356 0.39
357 0.4
358 0.4
359 0.37
360 0.4
361 0.33
362 0.33
363 0.29
364 0.26
365 0.23
366 0.19
367 0.17
368 0.11
369 0.1
370 0.07
371 0.06
372 0.04
373 0.04
374 0.04
375 0.06
376 0.07
377 0.07
378 0.1
379 0.12
380 0.14
381 0.15
382 0.17
383 0.17
384 0.18
385 0.18
386 0.15
387 0.14
388 0.12
389 0.11
390 0.08
391 0.08
392 0.08
393 0.12
394 0.14
395 0.15
396 0.2
397 0.24
398 0.3
399 0.31
400 0.3
401 0.29
402 0.35
403 0.35
404 0.34
405 0.3
406 0.24
407 0.22
408 0.22
409 0.19
410 0.11
411 0.1
412 0.06
413 0.05
414 0.05
415 0.05
416 0.05
417 0.06
418 0.06
419 0.09
420 0.11
421 0.12
422 0.15
423 0.17
424 0.24
425 0.27
426 0.3
427 0.33
428 0.38
429 0.4
430 0.42
431 0.44
432 0.41
433 0.45
434 0.47
435 0.44
436 0.38
437 0.36
438 0.32
439 0.32
440 0.29
441 0.22
442 0.17
443 0.17
444 0.19
445 0.2
446 0.21
447 0.21
448 0.21
449 0.21
450 0.22
451 0.2
452 0.19
453 0.18
454 0.16
455 0.14
456 0.15
457 0.13
458 0.12
459 0.12
460 0.1
461 0.09
462 0.09
463 0.08
464 0.1
465 0.1
466 0.11
467 0.15
468 0.17
469 0.21
470 0.22
471 0.22
472 0.24
473 0.25
474 0.28
475 0.27
476 0.25
477 0.24
478 0.25
479 0.24
480 0.2
481 0.19
482 0.16
483 0.13
484 0.12
485 0.1
486 0.08
487 0.08
488 0.07
489 0.07
490 0.06
491 0.06
492 0.07