Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0MWF1

Protein Details
Accession A0A0L0MWF1    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
120-146AGTKGATPKPRKKRSKMFASCRTQRKPHydrophilic
NLS Segment(s)
PositionSequence
121-135GTKGATPKPRKKRSK
Subcellular Location(s) nucl 16.5, cyto_nucl 10.5, mito 6, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MPGSSGPQTNPTSRVTSEPRDSSPGPDDQDILLTTRPGSELEENASQATDAASVTSGQLRVVNRDYEIIGPGRRERQDVPAVPGDGPCESADSGPRQDVVHSDHNSHVKRQQRASRGTVAGTKGATPKPRKKRSKMFASCRTQRKPLSRYSGKWYKVSRLTDVRRCNGSVQFKAEWTPVWIPISDLGGKEAYKEAEELFXEKFGPGDWDNASRGWKPDEEPEVECEIQYASD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.38
3 0.42
4 0.47
5 0.48
6 0.47
7 0.5
8 0.49
9 0.47
10 0.44
11 0.41
12 0.37
13 0.34
14 0.32
15 0.26
16 0.27
17 0.23
18 0.2
19 0.16
20 0.13
21 0.12
22 0.12
23 0.12
24 0.1
25 0.14
26 0.14
27 0.15
28 0.18
29 0.2
30 0.2
31 0.2
32 0.19
33 0.15
34 0.13
35 0.11
36 0.07
37 0.05
38 0.05
39 0.05
40 0.05
41 0.06
42 0.08
43 0.08
44 0.08
45 0.11
46 0.12
47 0.16
48 0.18
49 0.19
50 0.17
51 0.18
52 0.19
53 0.16
54 0.18
55 0.16
56 0.15
57 0.16
58 0.18
59 0.23
60 0.23
61 0.26
62 0.25
63 0.3
64 0.36
65 0.36
66 0.37
67 0.35
68 0.35
69 0.32
70 0.31
71 0.25
72 0.17
73 0.17
74 0.12
75 0.1
76 0.09
77 0.09
78 0.11
79 0.12
80 0.13
81 0.12
82 0.13
83 0.12
84 0.12
85 0.13
86 0.16
87 0.22
88 0.22
89 0.23
90 0.25
91 0.32
92 0.33
93 0.33
94 0.32
95 0.32
96 0.35
97 0.4
98 0.44
99 0.44
100 0.48
101 0.5
102 0.5
103 0.44
104 0.4
105 0.36
106 0.3
107 0.24
108 0.19
109 0.17
110 0.15
111 0.17
112 0.23
113 0.28
114 0.37
115 0.47
116 0.57
117 0.66
118 0.71
119 0.79
120 0.82
121 0.85
122 0.86
123 0.85
124 0.84
125 0.84
126 0.83
127 0.82
128 0.77
129 0.72
130 0.68
131 0.67
132 0.61
133 0.6
134 0.62
135 0.6
136 0.59
137 0.61
138 0.64
139 0.58
140 0.6
141 0.55
142 0.52
143 0.53
144 0.53
145 0.5
146 0.5
147 0.55
148 0.57
149 0.61
150 0.58
151 0.54
152 0.52
153 0.49
154 0.47
155 0.47
156 0.41
157 0.4
158 0.37
159 0.34
160 0.35
161 0.32
162 0.25
163 0.23
164 0.21
165 0.19
166 0.19
167 0.18
168 0.17
169 0.18
170 0.2
171 0.17
172 0.15
173 0.14
174 0.15
175 0.15
176 0.15
177 0.16
178 0.14
179 0.13
180 0.13
181 0.12
182 0.15
183 0.17
184 0.17
185 0.19
186 0.19
187 0.18
188 0.17
189 0.19
190 0.19
191 0.18
192 0.19
193 0.18
194 0.2
195 0.22
196 0.24
197 0.26
198 0.24
199 0.26
200 0.27
201 0.27
202 0.27
203 0.34
204 0.38
205 0.38
206 0.38
207 0.39
208 0.41
209 0.39
210 0.36
211 0.28