Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0NGF3

Protein Details
Accession A0A0L0NGF3    Localization Confidence Low Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MSRLLPRHHRKPPSSRRFASTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, nucl 4.5, cyto_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036428  PCD_sf  
IPR001533  Pterin_deHydtase  
Gene Ontology GO:0008124  F:4-alpha-hydroxytetrahydrobiopterin dehydratase activity  
GO:0006729  P:tetrahydrobiopterin biosynthetic process  
Pfam View protein in Pfam  
PF01329  Pterin_4a  
CDD cd00488  PCD_DCoH  
Amino Acid Sequences MSRLLPRHHRKPPSSRRFASTVQPRFSSGTNEATVSRALAPLLSTSGGRWTLASDGRALERSFKFKTFAKTWDFMTAVSLQCKVKNHHPEWSNVYSTTSIRWTTHNPLGLSDKDVSMAAACDAIAKDFGELEPEPASCTARDLTDKAAAYATGDSCTPKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.82
3 0.77
4 0.73
5 0.68
6 0.66
7 0.66
8 0.63
9 0.57
10 0.54
11 0.51
12 0.48
13 0.46
14 0.41
15 0.34
16 0.3
17 0.27
18 0.26
19 0.25
20 0.24
21 0.23
22 0.18
23 0.15
24 0.1
25 0.09
26 0.08
27 0.08
28 0.07
29 0.08
30 0.08
31 0.07
32 0.07
33 0.1
34 0.1
35 0.1
36 0.1
37 0.09
38 0.12
39 0.13
40 0.14
41 0.12
42 0.12
43 0.13
44 0.15
45 0.14
46 0.18
47 0.18
48 0.22
49 0.23
50 0.23
51 0.25
52 0.26
53 0.33
54 0.3
55 0.33
56 0.33
57 0.32
58 0.32
59 0.33
60 0.3
61 0.23
62 0.22
63 0.19
64 0.15
65 0.15
66 0.15
67 0.12
68 0.14
69 0.17
70 0.18
71 0.24
72 0.33
73 0.34
74 0.39
75 0.4
76 0.42
77 0.46
78 0.46
79 0.39
80 0.3
81 0.3
82 0.24
83 0.23
84 0.2
85 0.16
86 0.14
87 0.14
88 0.16
89 0.19
90 0.24
91 0.28
92 0.31
93 0.29
94 0.29
95 0.33
96 0.31
97 0.29
98 0.24
99 0.2
100 0.16
101 0.16
102 0.13
103 0.1
104 0.09
105 0.06
106 0.05
107 0.05
108 0.06
109 0.06
110 0.06
111 0.07
112 0.06
113 0.07
114 0.07
115 0.07
116 0.1
117 0.1
118 0.12
119 0.12
120 0.12
121 0.14
122 0.14
123 0.16
124 0.12
125 0.14
126 0.13
127 0.15
128 0.18
129 0.18
130 0.21
131 0.26
132 0.26
133 0.24
134 0.24
135 0.21
136 0.2
137 0.21
138 0.18
139 0.13
140 0.13