Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0NLS7

Protein Details
Accession A0A0L0NLS7   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
8-34GQVRHGRKTLERRRCVKKQTSYIHERNHydrophilic
108-130FSLTTHHNKRPKRLEGRVNELESHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, mito 8, cyto 7
Family & Domain DBs
Amino Acid Sequences MSRQRGEGQVRHGRKTLERRRCVKKQTSYIHERNPFGTLLQQTMNLIRPCMYGAVGLQLDARVIACLPVQRRPYASKTSNGALRLAAAAGPDHDLTAQGRVQARGESFSLTTHHNKRPKRLEGRVNELES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.6
3 0.62
4 0.62
5 0.67
6 0.71
7 0.78
8 0.84
9 0.85
10 0.84
11 0.83
12 0.82
13 0.82
14 0.82
15 0.82
16 0.8
17 0.79
18 0.76
19 0.67
20 0.58
21 0.51
22 0.42
23 0.33
24 0.3
25 0.22
26 0.17
27 0.16
28 0.15
29 0.14
30 0.15
31 0.21
32 0.16
33 0.16
34 0.14
35 0.14
36 0.14
37 0.14
38 0.12
39 0.07
40 0.06
41 0.09
42 0.08
43 0.08
44 0.07
45 0.07
46 0.06
47 0.06
48 0.06
49 0.03
50 0.03
51 0.03
52 0.04
53 0.06
54 0.08
55 0.14
56 0.16
57 0.17
58 0.19
59 0.23
60 0.27
61 0.33
62 0.34
63 0.32
64 0.34
65 0.36
66 0.37
67 0.34
68 0.3
69 0.21
70 0.19
71 0.15
72 0.12
73 0.09
74 0.06
75 0.05
76 0.05
77 0.07
78 0.07
79 0.06
80 0.06
81 0.07
82 0.07
83 0.1
84 0.1
85 0.12
86 0.14
87 0.15
88 0.17
89 0.18
90 0.19
91 0.19
92 0.19
93 0.17
94 0.16
95 0.16
96 0.17
97 0.19
98 0.26
99 0.31
100 0.39
101 0.46
102 0.51
103 0.61
104 0.69
105 0.74
106 0.77
107 0.79
108 0.8
109 0.81
110 0.84