Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0G2I9Y1

Protein Details
Accession A0A0G2I9Y1    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MPPAVHSPPPRRRRTRLHRLTSQVLPHydrophilic
NLS Segment(s)
PositionSequence
142-173KAVKVKVAKVKAVKVKAVKVKVKVKVKVKVAK
Subcellular Location(s) mito 18, cyto 5.5, cyto_nucl 4, nucl 1.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPPAVHSPPPRRRRTRLHRLTSQVLPQLLALLQPVALLQVLHLKVVRVDKVDKVDKVGKGAHPRLLPLRVDRVDRVDRVAHPRLLPLRVDRVDRVDRAAHLRLPPLRVDKVARVARVALLQVLLLKVDKVAHLRLPPLKVDKAVKVKVAKVKAVKVKAVKVKVKVKVKVKVAKVVPPKAVLLRVAIRVPLLWALLAALLLRALLYRALLSSPWRPRIQFHRLVWFNRLQLKLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.88
3 0.89
4 0.88
5 0.87
6 0.85
7 0.83
8 0.77
9 0.72
10 0.66
11 0.55
12 0.46
13 0.37
14 0.3
15 0.24
16 0.19
17 0.13
18 0.08
19 0.07
20 0.06
21 0.06
22 0.05
23 0.05
24 0.05
25 0.05
26 0.11
27 0.12
28 0.13
29 0.13
30 0.13
31 0.16
32 0.2
33 0.22
34 0.19
35 0.21
36 0.24
37 0.31
38 0.37
39 0.34
40 0.36
41 0.4
42 0.37
43 0.38
44 0.38
45 0.36
46 0.4
47 0.42
48 0.42
49 0.36
50 0.38
51 0.39
52 0.39
53 0.36
54 0.3
55 0.34
56 0.32
57 0.34
58 0.32
59 0.35
60 0.35
61 0.33
62 0.33
63 0.28
64 0.29
65 0.33
66 0.36
67 0.32
68 0.29
69 0.32
70 0.32
71 0.31
72 0.29
73 0.25
74 0.29
75 0.29
76 0.31
77 0.28
78 0.32
79 0.33
80 0.32
81 0.32
82 0.25
83 0.24
84 0.25
85 0.26
86 0.22
87 0.19
88 0.23
89 0.22
90 0.23
91 0.24
92 0.23
93 0.23
94 0.22
95 0.23
96 0.21
97 0.28
98 0.29
99 0.26
100 0.23
101 0.22
102 0.21
103 0.2
104 0.18
105 0.09
106 0.06
107 0.06
108 0.06
109 0.05
110 0.05
111 0.04
112 0.04
113 0.04
114 0.04
115 0.06
116 0.07
117 0.08
118 0.1
119 0.12
120 0.15
121 0.18
122 0.19
123 0.21
124 0.23
125 0.23
126 0.24
127 0.26
128 0.29
129 0.33
130 0.33
131 0.36
132 0.34
133 0.38
134 0.41
135 0.41
136 0.4
137 0.36
138 0.41
139 0.43
140 0.44
141 0.44
142 0.42
143 0.46
144 0.48
145 0.52
146 0.51
147 0.52
148 0.57
149 0.6
150 0.65
151 0.65
152 0.66
153 0.66
154 0.69
155 0.69
156 0.64
157 0.64
158 0.58
159 0.59
160 0.6
161 0.57
162 0.51
163 0.45
164 0.44
165 0.37
166 0.37
167 0.29
168 0.25
169 0.22
170 0.22
171 0.21
172 0.2
173 0.18
174 0.16
175 0.16
176 0.13
177 0.1
178 0.07
179 0.07
180 0.06
181 0.06
182 0.06
183 0.05
184 0.04
185 0.04
186 0.04
187 0.04
188 0.04
189 0.04
190 0.04
191 0.05
192 0.05
193 0.06
194 0.07
195 0.09
196 0.13
197 0.21
198 0.29
199 0.36
200 0.39
201 0.4
202 0.46
203 0.54
204 0.59
205 0.6
206 0.57
207 0.61
208 0.63
209 0.66
210 0.65
211 0.62
212 0.58
213 0.56