Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G2FTP8

Protein Details
Accession A0A0G2FTP8    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
16-42GAAPKSTGQKRRGRPPRQPSPTPREVFHydrophilic
NLS Segment(s)
PositionSequence
21-33STGQKRRGRPPRQ
Subcellular Location(s) mito 13, nucl 9, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013087  Znf_C2H2_type  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
Amino Acid Sequences MPSYKTGPTTAQRSAGAAPKSTGQKRRGRPPRQPSPTPREVFERQAAPRYVPFLCEWTGCKAELENVARLRKHIHVVHGRMDPLLCRWAHCRDKARVFAQEFEFQDHVDEEHLTPFVWHVGDGQRNERPISKADETSEELPAYLLGTDGEQVTPWVKDQEIQDFLTWRENRRRLKHLLMQRDANAPSEDEDEDEDVSNEEPLSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.39
3 0.35
4 0.3
5 0.27
6 0.29
7 0.37
8 0.43
9 0.47
10 0.49
11 0.56
12 0.63
13 0.73
14 0.79
15 0.8
16 0.83
17 0.85
18 0.88
19 0.87
20 0.88
21 0.87
22 0.85
23 0.85
24 0.76
25 0.68
26 0.64
27 0.59
28 0.55
29 0.51
30 0.48
31 0.4
32 0.45
33 0.43
34 0.38
35 0.35
36 0.33
37 0.28
38 0.24
39 0.22
40 0.18
41 0.18
42 0.18
43 0.18
44 0.19
45 0.21
46 0.19
47 0.18
48 0.16
49 0.17
50 0.22
51 0.22
52 0.23
53 0.26
54 0.29
55 0.29
56 0.29
57 0.3
58 0.26
59 0.3
60 0.27
61 0.31
62 0.35
63 0.37
64 0.42
65 0.41
66 0.39
67 0.33
68 0.31
69 0.23
70 0.17
71 0.18
72 0.13
73 0.12
74 0.15
75 0.24
76 0.28
77 0.33
78 0.38
79 0.41
80 0.47
81 0.51
82 0.5
83 0.48
84 0.44
85 0.42
86 0.39
87 0.37
88 0.32
89 0.29
90 0.27
91 0.2
92 0.19
93 0.16
94 0.13
95 0.09
96 0.09
97 0.06
98 0.07
99 0.07
100 0.06
101 0.06
102 0.06
103 0.06
104 0.06
105 0.05
106 0.06
107 0.1
108 0.14
109 0.16
110 0.2
111 0.21
112 0.22
113 0.24
114 0.25
115 0.23
116 0.21
117 0.26
118 0.25
119 0.25
120 0.25
121 0.28
122 0.28
123 0.28
124 0.27
125 0.2
126 0.18
127 0.16
128 0.14
129 0.11
130 0.07
131 0.05
132 0.04
133 0.04
134 0.05
135 0.05
136 0.05
137 0.05
138 0.06
139 0.07
140 0.07
141 0.08
142 0.09
143 0.09
144 0.12
145 0.14
146 0.21
147 0.22
148 0.23
149 0.24
150 0.24
151 0.25
152 0.31
153 0.31
154 0.31
155 0.38
156 0.45
157 0.53
158 0.59
159 0.65
160 0.63
161 0.7
162 0.73
163 0.72
164 0.74
165 0.71
166 0.68
167 0.64
168 0.63
169 0.55
170 0.49
171 0.4
172 0.31
173 0.27
174 0.24
175 0.22
176 0.17
177 0.18
178 0.16
179 0.16
180 0.16
181 0.14
182 0.13
183 0.13
184 0.12