Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0G2H793

Protein Details
Accession A0A0G2H793    Localization Confidence High Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
13-42AATKAKPMKGQKVKKPKSTKADKLQKKYTSHydrophilic
60-82ELIGKGKKAKKDEKHKGGSRKFGBasic
NLS Segment(s)
PositionSequence
7-38KKKAAPAATKAKPMKGQKVKKPKSTKADKLQK
63-82GKGKKAKKDEKHKGGSRKFG
Subcellular Location(s) mito 15, nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR019034  UPF0390  
Gene Ontology GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF09495  DUF2462  
Amino Acid Sequences MAQGEIKKKAAPAATKAKPMKGQKVKKPKSTKADKLQKKYTSGMITKTEALLGERAGHLELIGKGKKAKKDEKHKGGSRKFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.52
3 0.53
4 0.53
5 0.56
6 0.58
7 0.61
8 0.61
9 0.66
10 0.67
11 0.76
12 0.8
13 0.81
14 0.85
15 0.82
16 0.82
17 0.83
18 0.82
19 0.82
20 0.84
21 0.83
22 0.81
23 0.81
24 0.75
25 0.68
26 0.6
27 0.54
28 0.48
29 0.41
30 0.36
31 0.3
32 0.28
33 0.25
34 0.23
35 0.19
36 0.14
37 0.13
38 0.11
39 0.08
40 0.08
41 0.07
42 0.08
43 0.08
44 0.07
45 0.06
46 0.08
47 0.1
48 0.14
49 0.16
50 0.17
51 0.22
52 0.28
53 0.34
54 0.41
55 0.49
56 0.54
57 0.64
58 0.74
59 0.79
60 0.84
61 0.87
62 0.89