Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G2I602

Protein Details
Accession A0A0G2I602   
Localization Confidence High
Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
12-40AAPKATRGRKGSRSRSPPKTPPRPRVLCPHydrophilic
106-130KEERAAKKDKKKEGKAESKEKKREEBasic
NLS Segment(s)
PositionSequence
3-35RRKNAGKALAAPKATRGRKGSRSRSPPKTPPRP
106-133KEERAAKKDKKKEGKAESKEKKREEKKA
Subcellular Location(s) nucl 15, mito 10
Family & Domain DBs
Amino Acid Sequences MPRRKNAGKALAAPKATRGRKGSRSRSPPKTPPRPRVLCPGCSTELTLHKMLSDTPEFIYASNTDMKKLSIECENESCAFYIEGVEGADETLPVNPLVEKCIRDAKEERAAKKDKKKEGKAESKEKKREEKKAEYAKYDPFSGTKEKEAKEGLERQKLQEVETEKIIKSWKKIKEAAEKLEKFENEAAATDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.54
3 0.52
4 0.5
5 0.49
6 0.51
7 0.59
8 0.69
9 0.72
10 0.72
11 0.8
12 0.83
13 0.86
14 0.87
15 0.87
16 0.87
17 0.88
18 0.88
19 0.87
20 0.88
21 0.84
22 0.78
23 0.79
24 0.74
25 0.69
26 0.62
27 0.58
28 0.5
29 0.44
30 0.42
31 0.35
32 0.35
33 0.33
34 0.3
35 0.25
36 0.22
37 0.22
38 0.21
39 0.21
40 0.17
41 0.14
42 0.14
43 0.16
44 0.15
45 0.15
46 0.16
47 0.12
48 0.12
49 0.17
50 0.16
51 0.15
52 0.16
53 0.16
54 0.16
55 0.16
56 0.16
57 0.15
58 0.18
59 0.19
60 0.2
61 0.22
62 0.21
63 0.21
64 0.19
65 0.14
66 0.12
67 0.1
68 0.08
69 0.06
70 0.06
71 0.05
72 0.05
73 0.04
74 0.04
75 0.04
76 0.03
77 0.03
78 0.03
79 0.04
80 0.04
81 0.04
82 0.05
83 0.05
84 0.07
85 0.09
86 0.1
87 0.11
88 0.18
89 0.19
90 0.23
91 0.25
92 0.28
93 0.35
94 0.39
95 0.4
96 0.4
97 0.46
98 0.5
99 0.57
100 0.6
101 0.6
102 0.66
103 0.72
104 0.74
105 0.77
106 0.8
107 0.79
108 0.82
109 0.82
110 0.82
111 0.83
112 0.79
113 0.8
114 0.77
115 0.79
116 0.77
117 0.76
118 0.76
119 0.78
120 0.77
121 0.71
122 0.66
123 0.63
124 0.56
125 0.48
126 0.38
127 0.29
128 0.28
129 0.29
130 0.28
131 0.29
132 0.33
133 0.32
134 0.35
135 0.36
136 0.35
137 0.36
138 0.43
139 0.43
140 0.47
141 0.47
142 0.46
143 0.51
144 0.49
145 0.43
146 0.39
147 0.36
148 0.29
149 0.33
150 0.33
151 0.27
152 0.29
153 0.34
154 0.32
155 0.36
156 0.41
157 0.44
158 0.48
159 0.54
160 0.61
161 0.65
162 0.7
163 0.72
164 0.74
165 0.68
166 0.64
167 0.66
168 0.57
169 0.5
170 0.45
171 0.38
172 0.28