Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q5KLV4

Protein Details
Accession Q5KLV4    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MGKRKAAKKPVAKKKAEPLSSHydrophilic
131-150DDRRKEPEDRAGKRRKVQEEBasic
NLS Segment(s)
PositionSequence
3-16KRKAAKKPVAKKKA
142-145GKRR
Subcellular Location(s) mito 14, mito_nucl 12.166, cyto_mito 9.666, nucl 9, cyto_nucl 7.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0008023  C:transcription elongation factor complex  
GO:0046872  F:metal ion binding  
GO:0000993  F:RNA polymerase II complex binding  
GO:0006368  P:transcription elongation by RNA polymerase II  
KEGG cne:CNB03940  -  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKAAKKPVAKKKAEPLSSVFKCLFCNHDKAVNVKLDKATMFGHLHCKVCGQKYSTPINNLSAAVDVYCDWVDACEEVRQQQPPKQRAPRGPDPLTHGQAGGAGYDPEGAEEDDEEQEYNFNDKDEEEDDRRKEPEDRAGKRRKVQEESEDEDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.83
3 0.75
4 0.68
5 0.61
6 0.62
7 0.57
8 0.54
9 0.45
10 0.36
11 0.35
12 0.34
13 0.34
14 0.27
15 0.31
16 0.29
17 0.33
18 0.34
19 0.34
20 0.38
21 0.39
22 0.36
23 0.33
24 0.32
25 0.27
26 0.25
27 0.25
28 0.2
29 0.18
30 0.19
31 0.17
32 0.24
33 0.26
34 0.27
35 0.25
36 0.27
37 0.26
38 0.29
39 0.31
40 0.28
41 0.29
42 0.33
43 0.41
44 0.41
45 0.41
46 0.38
47 0.37
48 0.33
49 0.29
50 0.24
51 0.16
52 0.13
53 0.09
54 0.08
55 0.06
56 0.06
57 0.06
58 0.05
59 0.05
60 0.05
61 0.05
62 0.05
63 0.06
64 0.06
65 0.07
66 0.09
67 0.11
68 0.15
69 0.17
70 0.21
71 0.29
72 0.32
73 0.41
74 0.47
75 0.52
76 0.55
77 0.62
78 0.67
79 0.67
80 0.63
81 0.57
82 0.56
83 0.55
84 0.5
85 0.42
86 0.32
87 0.24
88 0.23
89 0.21
90 0.14
91 0.08
92 0.06
93 0.06
94 0.06
95 0.06
96 0.05
97 0.06
98 0.06
99 0.05
100 0.06
101 0.07
102 0.07
103 0.08
104 0.08
105 0.07
106 0.08
107 0.08
108 0.11
109 0.09
110 0.09
111 0.09
112 0.09
113 0.12
114 0.14
115 0.19
116 0.23
117 0.3
118 0.32
119 0.35
120 0.36
121 0.36
122 0.38
123 0.37
124 0.42
125 0.45
126 0.5
127 0.57
128 0.67
129 0.72
130 0.75
131 0.8
132 0.79
133 0.76
134 0.75
135 0.75
136 0.73