Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G2HWQ8

Protein Details
Accession A0A0G2HWQ8   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
2-21GKARKTRKFAQALKDRRTTKBasic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto 7, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006984  Fcf1/Utp23  
IPR037503  Fcf1_PIN  
IPR029060  PIN-like_dom_sf  
IPR002716  PIN_dom  
Gene Ontology GO:0005730  C:nucleolus  
GO:0032040  C:small-subunit processome  
GO:0004540  F:RNA nuclease activity  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF04900  Fcf1  
CDD cd09864  PIN_Fcf1-like  
Amino Acid Sequences MGKARKTRKFAQALKDRRTTKDAQNDARHIPQVPSNLFFNANTSLKPPYQILLDTNFFAHSIRAKIDIETGLMDLLLAKCTPIVSDCVLAELEKLGPKYRLALRAARDERHQRLRCQHTGTYADDCIVQRVMQHRIYLVGTNDAELRRRLRKIPGVPLIAVAKGGYKVEKLPEAFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.81
3 0.75
4 0.69
5 0.68
6 0.63
7 0.61
8 0.62
9 0.63
10 0.63
11 0.68
12 0.67
13 0.66
14 0.64
15 0.57
16 0.48
17 0.41
18 0.35
19 0.34
20 0.31
21 0.29
22 0.27
23 0.26
24 0.26
25 0.24
26 0.23
27 0.22
28 0.2
29 0.18
30 0.19
31 0.21
32 0.2
33 0.21
34 0.19
35 0.15
36 0.16
37 0.17
38 0.16
39 0.17
40 0.19
41 0.17
42 0.17
43 0.16
44 0.14
45 0.13
46 0.12
47 0.1
48 0.1
49 0.1
50 0.13
51 0.13
52 0.13
53 0.14
54 0.14
55 0.12
56 0.11
57 0.1
58 0.07
59 0.06
60 0.06
61 0.05
62 0.05
63 0.05
64 0.04
65 0.04
66 0.04
67 0.04
68 0.05
69 0.05
70 0.06
71 0.06
72 0.08
73 0.08
74 0.08
75 0.09
76 0.08
77 0.08
78 0.06
79 0.06
80 0.07
81 0.07
82 0.08
83 0.09
84 0.09
85 0.13
86 0.16
87 0.2
88 0.22
89 0.26
90 0.27
91 0.37
92 0.39
93 0.37
94 0.4
95 0.42
96 0.46
97 0.53
98 0.53
99 0.49
100 0.56
101 0.62
102 0.61
103 0.59
104 0.54
105 0.49
106 0.49
107 0.46
108 0.4
109 0.32
110 0.27
111 0.24
112 0.22
113 0.19
114 0.16
115 0.13
116 0.12
117 0.16
118 0.21
119 0.2
120 0.21
121 0.19
122 0.21
123 0.22
124 0.23
125 0.2
126 0.19
127 0.17
128 0.17
129 0.2
130 0.19
131 0.2
132 0.21
133 0.26
134 0.28
135 0.32
136 0.35
137 0.41
138 0.49
139 0.54
140 0.61
141 0.63
142 0.6
143 0.56
144 0.56
145 0.49
146 0.39
147 0.32
148 0.23
149 0.16
150 0.14
151 0.15
152 0.13
153 0.13
154 0.15
155 0.2
156 0.26