Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q5KDE9

Protein Details
Accession Q5KDE9   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
116-137EELRKKQQAKQQSKEAHKPKHPBasic
NLS Segment(s)
PositionSequence
132-135HKPK
Subcellular Location(s) nucl 14.5, cyto_nucl 9.833, mito_nucl 9.833, mito 5
Family & Domain DBs
KEGG cne:CNG04230  -  
Amino Acid Sequences MDPETQLKQNPGYDPKHDSAGAKHPNLGQGHAGANPQTGEAFEYAPQGAHSRLDRKDERNHGDALADAKRVEKLEKHAEAEHERALKKPTAVAEAHGNEPSRGAQKDEELVGDDEEELRKKQQAKQQSKEAHKPKHP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.46
3 0.45
4 0.43
5 0.38
6 0.35
7 0.4
8 0.43
9 0.37
10 0.38
11 0.35
12 0.39
13 0.39
14 0.36
15 0.27
16 0.21
17 0.21
18 0.2
19 0.19
20 0.14
21 0.14
22 0.12
23 0.11
24 0.09
25 0.08
26 0.08
27 0.07
28 0.08
29 0.07
30 0.09
31 0.08
32 0.09
33 0.09
34 0.09
35 0.09
36 0.11
37 0.13
38 0.17
39 0.19
40 0.26
41 0.3
42 0.34
43 0.42
44 0.47
45 0.5
46 0.47
47 0.46
48 0.39
49 0.34
50 0.3
51 0.24
52 0.17
53 0.13
54 0.1
55 0.1
56 0.11
57 0.11
58 0.12
59 0.1
60 0.15
61 0.22
62 0.24
63 0.26
64 0.26
65 0.29
66 0.31
67 0.31
68 0.29
69 0.25
70 0.24
71 0.23
72 0.25
73 0.23
74 0.2
75 0.21
76 0.19
77 0.19
78 0.19
79 0.19
80 0.23
81 0.23
82 0.25
83 0.25
84 0.24
85 0.19
86 0.2
87 0.2
88 0.18
89 0.17
90 0.18
91 0.17
92 0.18
93 0.21
94 0.21
95 0.19
96 0.18
97 0.18
98 0.15
99 0.14
100 0.12
101 0.11
102 0.13
103 0.14
104 0.13
105 0.14
106 0.19
107 0.24
108 0.3
109 0.37
110 0.46
111 0.54
112 0.61
113 0.69
114 0.74
115 0.79
116 0.83
117 0.85