Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0G2F411

Protein Details
Accession A0A0G2F411    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MGKYDRKEKSQPKHGKPPSSGASHydrophilic
33-57VPGWKGPGYIHKKKKPPQPSAGSGSHydrophilic
NLS Segment(s)
PositionSequence
6-49RKEKSQPKHGKPPSSGASKAPARITPGVPGWKGPGYIHKKKKPP
Subcellular Location(s) nucl 12.5, cyto_nucl 10.5, cyto 7.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR021463  Methyltransf_34  
Pfam View protein in Pfam  
PF11312  Methyltransf_34  
Amino Acid Sequences MGKYDRKEKSQPKHGKPPSSGASKAPARITPGVPGWKGPGYIHKKKKPPQPSAGSGSAATAEPPRLDHVLPIELEQLMINVFRDTFPASNDFEALKPTLQGIKDALFRRDFDMAFGRADFLEAYAIRWSPSRALGYAQLMAWICGERADDACIQRLMGGEQGIKPAKVVCFGGGAAEIMAFSGLVRHLRPSDAAGKPDSSSEDVSKDLQGLSIAEGDSSSPLLDLHLIDTADWASVLSKLQACLETAPTLSKYASAAARATNASFLSPGAVKHTFTRTDVLSCSTEDLRAAIGPDPALLTLLFTLNELYTASMPRTTSLLLRLAEATPKGSLLLVVDSPGSYSETAIGNAKEGQEKKKYPMSWLMDYALVPKPKKKTGDDEAGEGESISAWEKVIEEASMWYRLEEDLEYPVSLENMRFQVHVFKRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.88
3 0.82
4 0.8
5 0.77
6 0.74
7 0.66
8 0.58
9 0.58
10 0.53
11 0.53
12 0.48
13 0.42
14 0.41
15 0.43
16 0.41
17 0.38
18 0.4
19 0.42
20 0.39
21 0.38
22 0.36
23 0.33
24 0.33
25 0.3
26 0.34
27 0.37
28 0.47
29 0.56
30 0.61
31 0.69
32 0.76
33 0.84
34 0.85
35 0.85
36 0.85
37 0.83
38 0.81
39 0.78
40 0.73
41 0.65
42 0.54
43 0.45
44 0.36
45 0.27
46 0.2
47 0.15
48 0.13
49 0.12
50 0.13
51 0.15
52 0.17
53 0.17
54 0.17
55 0.18
56 0.21
57 0.21
58 0.2
59 0.19
60 0.16
61 0.16
62 0.14
63 0.11
64 0.08
65 0.08
66 0.08
67 0.06
68 0.07
69 0.07
70 0.09
71 0.11
72 0.11
73 0.13
74 0.16
75 0.18
76 0.18
77 0.19
78 0.19
79 0.16
80 0.18
81 0.17
82 0.14
83 0.12
84 0.13
85 0.16
86 0.15
87 0.17
88 0.16
89 0.18
90 0.24
91 0.27
92 0.29
93 0.27
94 0.28
95 0.29
96 0.31
97 0.28
98 0.24
99 0.26
100 0.23
101 0.22
102 0.21
103 0.19
104 0.15
105 0.15
106 0.12
107 0.08
108 0.09
109 0.08
110 0.09
111 0.1
112 0.1
113 0.1
114 0.11
115 0.12
116 0.11
117 0.15
118 0.15
119 0.14
120 0.16
121 0.18
122 0.19
123 0.19
124 0.17
125 0.17
126 0.15
127 0.14
128 0.13
129 0.1
130 0.08
131 0.08
132 0.08
133 0.07
134 0.07
135 0.09
136 0.12
137 0.12
138 0.15
139 0.14
140 0.14
141 0.13
142 0.13
143 0.11
144 0.1
145 0.1
146 0.09
147 0.1
148 0.15
149 0.15
150 0.14
151 0.14
152 0.14
153 0.14
154 0.14
155 0.14
156 0.1
157 0.1
158 0.1
159 0.1
160 0.08
161 0.07
162 0.06
163 0.05
164 0.04
165 0.03
166 0.03
167 0.03
168 0.02
169 0.03
170 0.04
171 0.05
172 0.05
173 0.07
174 0.08
175 0.09
176 0.09
177 0.11
178 0.18
179 0.19
180 0.21
181 0.2
182 0.21
183 0.21
184 0.21
185 0.2
186 0.14
187 0.13
188 0.13
189 0.13
190 0.13
191 0.13
192 0.13
193 0.12
194 0.1
195 0.08
196 0.07
197 0.07
198 0.06
199 0.06
200 0.06
201 0.05
202 0.05
203 0.05
204 0.05
205 0.05
206 0.04
207 0.03
208 0.03
209 0.03
210 0.04
211 0.04
212 0.04
213 0.06
214 0.06
215 0.06
216 0.06
217 0.06
218 0.05
219 0.05
220 0.05
221 0.04
222 0.04
223 0.05
224 0.06
225 0.06
226 0.07
227 0.08
228 0.08
229 0.09
230 0.09
231 0.1
232 0.09
233 0.09
234 0.1
235 0.1
236 0.1
237 0.1
238 0.09
239 0.08
240 0.1
241 0.11
242 0.11
243 0.11
244 0.11
245 0.13
246 0.12
247 0.12
248 0.11
249 0.1
250 0.09
251 0.08
252 0.08
253 0.08
254 0.08
255 0.08
256 0.11
257 0.12
258 0.13
259 0.15
260 0.19
261 0.2
262 0.2
263 0.23
264 0.19
265 0.2
266 0.2
267 0.21
268 0.18
269 0.17
270 0.18
271 0.16
272 0.15
273 0.13
274 0.12
275 0.1
276 0.09
277 0.1
278 0.09
279 0.09
280 0.08
281 0.08
282 0.08
283 0.08
284 0.08
285 0.06
286 0.05
287 0.05
288 0.06
289 0.06
290 0.06
291 0.06
292 0.06
293 0.06
294 0.06
295 0.06
296 0.07
297 0.08
298 0.09
299 0.1
300 0.1
301 0.11
302 0.12
303 0.12
304 0.12
305 0.15
306 0.19
307 0.17
308 0.18
309 0.19
310 0.18
311 0.2
312 0.19
313 0.17
314 0.13
315 0.13
316 0.12
317 0.1
318 0.1
319 0.08
320 0.09
321 0.08
322 0.08
323 0.08
324 0.08
325 0.08
326 0.09
327 0.09
328 0.07
329 0.08
330 0.09
331 0.1
332 0.11
333 0.14
334 0.13
335 0.13
336 0.15
337 0.16
338 0.21
339 0.24
340 0.29
341 0.35
342 0.39
343 0.43
344 0.49
345 0.49
346 0.47
347 0.54
348 0.54
349 0.5
350 0.49
351 0.45
352 0.39
353 0.38
354 0.36
355 0.33
356 0.32
357 0.29
358 0.33
359 0.38
360 0.43
361 0.5
362 0.51
363 0.54
364 0.57
365 0.66
366 0.62
367 0.59
368 0.55
369 0.49
370 0.43
371 0.34
372 0.25
373 0.14
374 0.13
375 0.1
376 0.07
377 0.07
378 0.07
379 0.08
380 0.09
381 0.1
382 0.09
383 0.09
384 0.12
385 0.15
386 0.18
387 0.17
388 0.16
389 0.16
390 0.16
391 0.17
392 0.15
393 0.14
394 0.14
395 0.16
396 0.16
397 0.15
398 0.15
399 0.15
400 0.15
401 0.14
402 0.15
403 0.17
404 0.18
405 0.18
406 0.19
407 0.28