Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P0CQ50

Protein Details
Accession P0CQ50   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
2-33VNIPKTRRTYCKGKACRKHTPHKVTQYKKGKDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, mito 8, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0046677  P:response to antibiotic  
GO:0046898  P:response to cycloheximide  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNIPKTRRTYCKGKACRKHTPHKVTQYKKGKDSLSAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECTVCKTKHQLALKRCKHFELGGDKKQRGAAISF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.83
3 0.83
4 0.88
5 0.86
6 0.87
7 0.87
8 0.86
9 0.85
10 0.85
11 0.88
12 0.83
13 0.85
14 0.85
15 0.8
16 0.75
17 0.71
18 0.61
19 0.56
20 0.54
21 0.53
22 0.53
23 0.53
24 0.54
25 0.55
26 0.58
27 0.58
28 0.6
29 0.58
30 0.57
31 0.6
32 0.61
33 0.61
34 0.61
35 0.61
36 0.59
37 0.59
38 0.5
39 0.45
40 0.41
41 0.33
42 0.35
43 0.37
44 0.35
45 0.3
46 0.37
47 0.41
48 0.5
49 0.58
50 0.61
51 0.61
52 0.64
53 0.71
54 0.72
55 0.7
56 0.67
57 0.62
58 0.59
59 0.57
60 0.52
61 0.48
62 0.46
63 0.4
64 0.38
65 0.39
66 0.4
67 0.43
68 0.5
69 0.54
70 0.57
71 0.67
72 0.71
73 0.74
74 0.71
75 0.66
76 0.61
77 0.54
78 0.52
79 0.51
80 0.52
81 0.52
82 0.59
83 0.57
84 0.55
85 0.56
86 0.5