Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G2HDU2

Protein Details
Accession A0A0G2HDU2   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
15-41LLWKTPWRLSKFQKRRQRLRLRAVDSVHydrophilic
77-103KYTIFDRKEKRYRKGIHKLPKWTRVSQHydrophilic
NLS Segment(s)
PositionSequence
83-97RKEKRYRKGIHKLPK
Subcellular Location(s) mito 22, mito_nucl 12.833, cyto_mito 12.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFRFTNPLSSGLLWKTPWRLSKFQKRRQRLRLRAVDSVVATLDGALAKKGETTKSVERWKAEMPKEEEMRAKDKYTIFDRKEKRYRKGIHKLPKWTRVSQRLNPPGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.23
3 0.21
4 0.23
5 0.26
6 0.29
7 0.36
8 0.38
9 0.44
10 0.52
11 0.62
12 0.7
13 0.75
14 0.8
15 0.83
16 0.87
17 0.9
18 0.91
19 0.9
20 0.89
21 0.89
22 0.83
23 0.77
24 0.68
25 0.59
26 0.48
27 0.38
28 0.28
29 0.18
30 0.12
31 0.08
32 0.07
33 0.05
34 0.04
35 0.04
36 0.04
37 0.04
38 0.05
39 0.07
40 0.07
41 0.08
42 0.13
43 0.18
44 0.25
45 0.31
46 0.32
47 0.33
48 0.35
49 0.38
50 0.41
51 0.4
52 0.4
53 0.39
54 0.43
55 0.43
56 0.43
57 0.42
58 0.37
59 0.38
60 0.33
61 0.3
62 0.28
63 0.28
64 0.31
65 0.34
66 0.4
67 0.4
68 0.47
69 0.53
70 0.58
71 0.66
72 0.7
73 0.7
74 0.71
75 0.77
76 0.78
77 0.82
78 0.82
79 0.83
80 0.83
81 0.87
82 0.86
83 0.87
84 0.82
85 0.8
86 0.8
87 0.79
88 0.8
89 0.77
90 0.79