Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0G2I510

Protein Details
Accession A0A0G2I510    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
77-102KTPANMRTPNPKKRSKKQAAEKEDDTHydrophilic
NLS Segment(s)
PositionSequence
74-94GPKKTPANMRTPNPKKRSKKQ
Subcellular Location(s) nucl 16, cyto_nucl 13, cyto 8
Family & Domain DBs
Amino Acid Sequences MSSNNFGLSDNELKIALCALKVTVVDGKVEKGHLAKLTGHANPDSAQRVWYMVKKKIMETNITSLVDVDTPTKGPKKTPANMRTPNPKKRSKKQAAEKEDDTDAEVDEKPAKRVKKEVVEDTGLDMIEDEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.13
4 0.09
5 0.08
6 0.08
7 0.09
8 0.09
9 0.11
10 0.12
11 0.12
12 0.14
13 0.14
14 0.16
15 0.15
16 0.16
17 0.15
18 0.13
19 0.16
20 0.15
21 0.16
22 0.16
23 0.19
24 0.22
25 0.22
26 0.23
27 0.2
28 0.2
29 0.19
30 0.21
31 0.2
32 0.16
33 0.15
34 0.14
35 0.15
36 0.16
37 0.21
38 0.23
39 0.25
40 0.3
41 0.31
42 0.32
43 0.36
44 0.36
45 0.34
46 0.31
47 0.3
48 0.28
49 0.27
50 0.25
51 0.2
52 0.18
53 0.14
54 0.12
55 0.09
56 0.06
57 0.06
58 0.08
59 0.12
60 0.12
61 0.14
62 0.22
63 0.29
64 0.35
65 0.45
66 0.5
67 0.56
68 0.62
69 0.66
70 0.69
71 0.71
72 0.74
73 0.72
74 0.75
75 0.74
76 0.78
77 0.84
78 0.83
79 0.84
80 0.85
81 0.88
82 0.87
83 0.85
84 0.77
85 0.69
86 0.6
87 0.5
88 0.4
89 0.3
90 0.22
91 0.16
92 0.14
93 0.12
94 0.17
95 0.18
96 0.2
97 0.26
98 0.3
99 0.32
100 0.39
101 0.46
102 0.51
103 0.57
104 0.61
105 0.6
106 0.59
107 0.56
108 0.51
109 0.44
110 0.34
111 0.26