Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0S2M5T9

Protein Details
Accession A0A0S2M5T9    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
26-48STSSTASDPPRRRRSNRNDTPATHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 11, cyto_nucl 7.5, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR018796  COA8  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0005739  C:mitochondrion  
GO:0097193  P:intrinsic apoptotic signaling pathway  
Pfam View protein in Pfam  
PF10231  COA8  
Amino Acid Sequences MTMLPTARPRVAHILPYIQHFTASTSTSSTASDPPRRRRSNRNDTPATGVDLVAPPDPLSNIRPILYASKPPTRPSANSPYSASEFPSSSGDAKLDNMELEWRLRRERVDLTNHRFWAANNIAFNAQLDHRLSLLPPASDPPSPEDIRRKEDCLTQFYADWQMANQERQIRWVKEWWREIWEGLRIQARLYVMRALRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.37
3 0.42
4 0.42
5 0.33
6 0.31
7 0.27
8 0.26
9 0.22
10 0.22
11 0.17
12 0.15
13 0.17
14 0.17
15 0.18
16 0.17
17 0.2
18 0.26
19 0.35
20 0.42
21 0.51
22 0.61
23 0.69
24 0.73
25 0.79
26 0.82
27 0.84
28 0.85
29 0.85
30 0.8
31 0.73
32 0.73
33 0.63
34 0.56
35 0.45
36 0.34
37 0.25
38 0.2
39 0.19
40 0.13
41 0.12
42 0.09
43 0.08
44 0.09
45 0.1
46 0.1
47 0.12
48 0.13
49 0.13
50 0.14
51 0.15
52 0.18
53 0.18
54 0.23
55 0.25
56 0.31
57 0.33
58 0.34
59 0.39
60 0.38
61 0.39
62 0.4
63 0.45
64 0.4
65 0.41
66 0.4
67 0.37
68 0.36
69 0.34
70 0.28
71 0.2
72 0.17
73 0.16
74 0.16
75 0.14
76 0.12
77 0.12
78 0.11
79 0.09
80 0.1
81 0.09
82 0.08
83 0.07
84 0.06
85 0.06
86 0.07
87 0.08
88 0.09
89 0.1
90 0.12
91 0.13
92 0.14
93 0.16
94 0.21
95 0.24
96 0.32
97 0.39
98 0.45
99 0.49
100 0.49
101 0.47
102 0.42
103 0.36
104 0.35
105 0.3
106 0.25
107 0.2
108 0.21
109 0.2
110 0.2
111 0.2
112 0.13
113 0.1
114 0.11
115 0.11
116 0.1
117 0.11
118 0.11
119 0.11
120 0.13
121 0.14
122 0.11
123 0.1
124 0.13
125 0.15
126 0.15
127 0.17
128 0.17
129 0.22
130 0.23
131 0.27
132 0.34
133 0.36
134 0.42
135 0.44
136 0.43
137 0.39
138 0.45
139 0.44
140 0.4
141 0.4
142 0.35
143 0.32
144 0.31
145 0.32
146 0.26
147 0.22
148 0.17
149 0.19
150 0.2
151 0.22
152 0.23
153 0.26
154 0.26
155 0.33
156 0.41
157 0.38
158 0.38
159 0.45
160 0.49
161 0.51
162 0.57
163 0.53
164 0.51
165 0.5
166 0.49
167 0.45
168 0.44
169 0.36
170 0.35
171 0.37
172 0.31
173 0.3
174 0.31
175 0.28
176 0.24
177 0.24
178 0.27