Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G2FGP4

Protein Details
Accession A0A0G2FGP4    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
168-187TPPGIKIKSKKEHRGLPRDLBasic
NLS Segment(s)
Subcellular Location(s) nucl 9cyto 9cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MELCLKQLIEWTRLKNRSVPDPAEENALARYSWLVFDPCIPDYVELTKAARKEVVKAASLTEDLEGDFWFGHLCRSGMVIDTLWEKSAYQLTYPWLIKDDKYPLGRPMATPKSMAKKRLVKWDRVDLRSSEGCENSLDDLFHFPAKKWVVDDYGSDSELFKMRQEGETPPGIKIKSKKEHRGLPRDLHMQILEFFDEQREQDRLYPEAAIEGFSDRYQEDPKAASRQCTCRCAPVRDDEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.51
3 0.52
4 0.55
5 0.57
6 0.53
7 0.48
8 0.48
9 0.47
10 0.46
11 0.42
12 0.33
13 0.27
14 0.24
15 0.18
16 0.14
17 0.15
18 0.1
19 0.1
20 0.11
21 0.11
22 0.11
23 0.14
24 0.17
25 0.16
26 0.17
27 0.17
28 0.16
29 0.17
30 0.19
31 0.17
32 0.16
33 0.17
34 0.19
35 0.19
36 0.19
37 0.22
38 0.2
39 0.23
40 0.28
41 0.3
42 0.29
43 0.29
44 0.28
45 0.26
46 0.25
47 0.21
48 0.14
49 0.11
50 0.09
51 0.09
52 0.08
53 0.06
54 0.06
55 0.05
56 0.05
57 0.05
58 0.06
59 0.07
60 0.07
61 0.07
62 0.08
63 0.08
64 0.08
65 0.09
66 0.08
67 0.08
68 0.1
69 0.1
70 0.09
71 0.09
72 0.09
73 0.09
74 0.13
75 0.12
76 0.1
77 0.11
78 0.13
79 0.18
80 0.18
81 0.17
82 0.16
83 0.17
84 0.17
85 0.2
86 0.22
87 0.23
88 0.25
89 0.26
90 0.26
91 0.29
92 0.28
93 0.25
94 0.29
95 0.28
96 0.26
97 0.26
98 0.27
99 0.34
100 0.37
101 0.39
102 0.38
103 0.42
104 0.45
105 0.55
106 0.55
107 0.52
108 0.52
109 0.59
110 0.58
111 0.52
112 0.5
113 0.4
114 0.41
115 0.36
116 0.34
117 0.26
118 0.19
119 0.18
120 0.16
121 0.16
122 0.13
123 0.12
124 0.09
125 0.08
126 0.09
127 0.1
128 0.11
129 0.11
130 0.1
131 0.16
132 0.17
133 0.18
134 0.17
135 0.18
136 0.18
137 0.19
138 0.2
139 0.19
140 0.19
141 0.19
142 0.18
143 0.17
144 0.16
145 0.17
146 0.16
147 0.1
148 0.12
149 0.13
150 0.14
151 0.16
152 0.17
153 0.19
154 0.24
155 0.25
156 0.23
157 0.26
158 0.25
159 0.27
160 0.31
161 0.38
162 0.42
163 0.51
164 0.59
165 0.64
166 0.73
167 0.78
168 0.81
169 0.78
170 0.74
171 0.72
172 0.68
173 0.6
174 0.53
175 0.44
176 0.35
177 0.29
178 0.24
179 0.19
180 0.14
181 0.13
182 0.13
183 0.13
184 0.13
185 0.15
186 0.15
187 0.15
188 0.19
189 0.22
190 0.22
191 0.22
192 0.22
193 0.18
194 0.19
195 0.18
196 0.14
197 0.12
198 0.13
199 0.13
200 0.12
201 0.14
202 0.11
203 0.14
204 0.17
205 0.17
206 0.18
207 0.2
208 0.24
209 0.32
210 0.34
211 0.39
212 0.42
213 0.51
214 0.56
215 0.59
216 0.57
217 0.58
218 0.63
219 0.62
220 0.6