Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0G2FVL4

Protein Details
Accession A0A0G2FVL4    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MAPSATGAKKQKKKWSKGKVKDKAQHAVIHydrophilic
NLS Segment(s)
PositionSequence
8-23AKKQKKKWSKGKVKDK
Subcellular Location(s) nucl 13.5, mito_nucl 10.5, mito 6.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPSATGAKKQKKKWSKGKVKDKAQHAVILDKATSDKLYKDVQSYRLVTVATLVDRLKINGSLARQCLKDLEEKGQIKPIVTHSKMKIYTRAVGASE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.87
3 0.88
4 0.9
5 0.93
6 0.92
7 0.92
8 0.89
9 0.85
10 0.82
11 0.72
12 0.65
13 0.55
14 0.48
15 0.39
16 0.32
17 0.25
18 0.18
19 0.16
20 0.13
21 0.13
22 0.1
23 0.09
24 0.11
25 0.14
26 0.15
27 0.18
28 0.2
29 0.23
30 0.27
31 0.27
32 0.25
33 0.23
34 0.22
35 0.18
36 0.16
37 0.13
38 0.08
39 0.09
40 0.08
41 0.09
42 0.09
43 0.1
44 0.09
45 0.09
46 0.1
47 0.11
48 0.13
49 0.15
50 0.18
51 0.21
52 0.2
53 0.2
54 0.21
55 0.2
56 0.23
57 0.22
58 0.25
59 0.31
60 0.32
61 0.33
62 0.39
63 0.38
64 0.32
65 0.33
66 0.35
67 0.36
68 0.38
69 0.44
70 0.4
71 0.48
72 0.52
73 0.53
74 0.53
75 0.48
76 0.5
77 0.46