Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G2HWT5

Protein Details
Accession A0A0G2HWT5   
Localization Confidence Low
Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
231-257VVDVIDKLSRRRRRRFRWARRAGWLALHydrophilic
NLS Segment(s)
PositionSequence
238-251LSRRRRRRFRWARR
Subcellular Location(s) mito 10, cyto 8.5, cyto_nucl 7, nucl 4.5, plas 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR038769  MTC4  
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MRLGDPGTGLRSLFKGPRIDSVLKSGVSKVSELLWKKESEAEDSDSSTSSSDGTDIEDRGRRKQAKSLSPSASIRGRREVARVKALMLSSGVMAMNISRRAHQAQMLNVMTTNESSDVLSALGNRVSWPEITQLAPVDQRQELLSKPISEADLFPVAARVLGTAIQTSRQRWESAAESFRHRTRSDVNGQIEHLRTRLQLDLSAMTRAAAEEADEVSEDLVDGQRRKVKAVVDVIDKLSRRRRRRFRWARRAGWLALEWALVGFMWYVWLVVMIARVFLGVGKGFVRGVRWLLWL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.3
3 0.31
4 0.38
5 0.43
6 0.45
7 0.42
8 0.45
9 0.44
10 0.38
11 0.38
12 0.33
13 0.29
14 0.27
15 0.25
16 0.19
17 0.19
18 0.25
19 0.27
20 0.3
21 0.3
22 0.29
23 0.3
24 0.35
25 0.32
26 0.3
27 0.31
28 0.31
29 0.29
30 0.3
31 0.29
32 0.24
33 0.23
34 0.18
35 0.15
36 0.1
37 0.09
38 0.07
39 0.07
40 0.1
41 0.12
42 0.12
43 0.16
44 0.21
45 0.23
46 0.28
47 0.37
48 0.39
49 0.4
50 0.47
51 0.52
52 0.56
53 0.62
54 0.65
55 0.59
56 0.59
57 0.58
58 0.55
59 0.53
60 0.49
61 0.44
62 0.42
63 0.4
64 0.36
65 0.42
66 0.46
67 0.44
68 0.45
69 0.43
70 0.38
71 0.37
72 0.36
73 0.29
74 0.21
75 0.17
76 0.1
77 0.1
78 0.09
79 0.06
80 0.06
81 0.05
82 0.08
83 0.11
84 0.11
85 0.11
86 0.14
87 0.16
88 0.18
89 0.22
90 0.22
91 0.21
92 0.28
93 0.27
94 0.24
95 0.23
96 0.22
97 0.18
98 0.15
99 0.13
100 0.07
101 0.07
102 0.06
103 0.06
104 0.06
105 0.06
106 0.06
107 0.06
108 0.06
109 0.06
110 0.06
111 0.06
112 0.06
113 0.07
114 0.07
115 0.07
116 0.08
117 0.09
118 0.1
119 0.11
120 0.1
121 0.1
122 0.12
123 0.11
124 0.11
125 0.1
126 0.1
127 0.1
128 0.11
129 0.1
130 0.12
131 0.13
132 0.11
133 0.11
134 0.12
135 0.12
136 0.11
137 0.11
138 0.1
139 0.1
140 0.09
141 0.09
142 0.09
143 0.08
144 0.07
145 0.07
146 0.05
147 0.04
148 0.05
149 0.05
150 0.05
151 0.05
152 0.09
153 0.11
154 0.12
155 0.16
156 0.16
157 0.17
158 0.17
159 0.2
160 0.19
161 0.22
162 0.26
163 0.24
164 0.27
165 0.31
166 0.33
167 0.34
168 0.31
169 0.29
170 0.29
171 0.34
172 0.36
173 0.4
174 0.4
175 0.38
176 0.39
177 0.39
178 0.36
179 0.3
180 0.24
181 0.17
182 0.15
183 0.15
184 0.16
185 0.13
186 0.13
187 0.14
188 0.16
189 0.16
190 0.16
191 0.14
192 0.12
193 0.12
194 0.1
195 0.09
196 0.06
197 0.05
198 0.05
199 0.06
200 0.06
201 0.06
202 0.06
203 0.05
204 0.05
205 0.05
206 0.04
207 0.07
208 0.1
209 0.11
210 0.15
211 0.21
212 0.21
213 0.23
214 0.26
215 0.26
216 0.3
217 0.35
218 0.36
219 0.35
220 0.37
221 0.38
222 0.39
223 0.38
224 0.37
225 0.4
226 0.46
227 0.51
228 0.6
229 0.68
230 0.74
231 0.85
232 0.9
233 0.92
234 0.93
235 0.94
236 0.9
237 0.88
238 0.83
239 0.73
240 0.66
241 0.55
242 0.46
243 0.36
244 0.28
245 0.19
246 0.14
247 0.12
248 0.07
249 0.07
250 0.05
251 0.04
252 0.05
253 0.05
254 0.05
255 0.05
256 0.05
257 0.05
258 0.05
259 0.08
260 0.07
261 0.08
262 0.07
263 0.08
264 0.07
265 0.08
266 0.09
267 0.07
268 0.08
269 0.09
270 0.1
271 0.11
272 0.12
273 0.14
274 0.15
275 0.17