Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G2F8P4

Protein Details
Accession A0A0G2F8P4    Localization Confidence Low Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
42-67PGYAQKSKQNQQKRYMKQQIHKNECTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, cyto_nucl 3, nucl 2.5, cyto 2.5, plas 1, extr 1, pero 1
Family & Domain DBs
Amino Acid Sequences MGPAAPVVNPIFGKNVPKPKVPNTTGQQYWEYWHELRRTFEPGYAQKSKQNQQKRYMKQQIHKNECTTDQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.37
3 0.37
4 0.42
5 0.47
6 0.51
7 0.59
8 0.56
9 0.57
10 0.52
11 0.56
12 0.52
13 0.5
14 0.44
15 0.35
16 0.34
17 0.28
18 0.26
19 0.2
20 0.22
21 0.22
22 0.23
23 0.24
24 0.24
25 0.27
26 0.24
27 0.24
28 0.26
29 0.27
30 0.32
31 0.35
32 0.34
33 0.35
34 0.42
35 0.48
36 0.52
37 0.58
38 0.58
39 0.64
40 0.73
41 0.76
42 0.8
43 0.82
44 0.82
45 0.8
46 0.83
47 0.83
48 0.82
49 0.8
50 0.73
51 0.67