Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G2FIT4

Protein Details
Accession A0A0G2FIT4   
Localization Confidence Low
Confidence Score 5.9
NoLS Segment(s)
PositionSequenceProtein Nature
255-274GDHPKIPIKPKIKTSNRAKIHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 15.5, cyto_nucl 11, pero 4, nucl 3.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036412  HAD-like_sf  
IPR023214  HAD_sf  
IPR023198  PGP-like_dom2  
Gene Ontology GO:0016791  F:phosphatase activity  
Amino Acid Sequences MLTLYKVVSPFQSILDYELSLGIPPGWVNYSISKTSPNGFWHRLERGEIPLDAAFIQGFSKDLHTPELWEAFYEDQRDRDPRLPESTPPVPDLDAEFLFNDMMSSAVAPDPWVYPALKNLKASGKYVLAALSNTVIFPPGHKLHRPDFVTDPVRSIFDVFVSSAHVGLRKPDPRIYELAVREVDKFARANADSPRGRALGWKDGVIPGDILFLDDIGQNLKAASKAGFRTIKVNLGRGFEAVEELESITGLALAGDHPKIPIKPKIKTSNRAKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.18
4 0.15
5 0.15
6 0.13
7 0.11
8 0.11
9 0.08
10 0.07
11 0.07
12 0.08
13 0.09
14 0.09
15 0.12
16 0.15
17 0.2
18 0.21
19 0.22
20 0.24
21 0.25
22 0.27
23 0.3
24 0.32
25 0.35
26 0.37
27 0.41
28 0.43
29 0.46
30 0.45
31 0.43
32 0.39
33 0.36
34 0.35
35 0.31
36 0.27
37 0.23
38 0.21
39 0.18
40 0.15
41 0.11
42 0.08
43 0.08
44 0.06
45 0.06
46 0.06
47 0.09
48 0.11
49 0.12
50 0.15
51 0.15
52 0.18
53 0.19
54 0.21
55 0.18
56 0.17
57 0.17
58 0.16
59 0.18
60 0.19
61 0.17
62 0.17
63 0.2
64 0.23
65 0.25
66 0.29
67 0.31
68 0.31
69 0.36
70 0.36
71 0.35
72 0.4
73 0.4
74 0.36
75 0.33
76 0.3
77 0.24
78 0.23
79 0.22
80 0.18
81 0.13
82 0.12
83 0.11
84 0.11
85 0.1
86 0.09
87 0.08
88 0.04
89 0.04
90 0.04
91 0.03
92 0.04
93 0.04
94 0.04
95 0.04
96 0.05
97 0.05
98 0.06
99 0.07
100 0.07
101 0.07
102 0.14
103 0.19
104 0.21
105 0.21
106 0.23
107 0.27
108 0.28
109 0.29
110 0.26
111 0.21
112 0.19
113 0.18
114 0.16
115 0.11
116 0.1
117 0.09
118 0.07
119 0.06
120 0.06
121 0.05
122 0.06
123 0.05
124 0.06
125 0.1
126 0.13
127 0.16
128 0.18
129 0.22
130 0.24
131 0.32
132 0.33
133 0.31
134 0.3
135 0.34
136 0.36
137 0.32
138 0.3
139 0.24
140 0.23
141 0.2
142 0.18
143 0.12
144 0.08
145 0.09
146 0.07
147 0.07
148 0.08
149 0.08
150 0.07
151 0.08
152 0.09
153 0.08
154 0.11
155 0.17
156 0.19
157 0.22
158 0.25
159 0.27
160 0.28
161 0.31
162 0.31
163 0.31
164 0.29
165 0.3
166 0.28
167 0.26
168 0.25
169 0.23
170 0.21
171 0.16
172 0.15
173 0.12
174 0.15
175 0.15
176 0.17
177 0.2
178 0.28
179 0.27
180 0.28
181 0.31
182 0.26
183 0.26
184 0.27
185 0.28
186 0.27
187 0.27
188 0.27
189 0.25
190 0.26
191 0.27
192 0.22
193 0.18
194 0.1
195 0.1
196 0.09
197 0.09
198 0.07
199 0.06
200 0.06
201 0.06
202 0.06
203 0.06
204 0.07
205 0.06
206 0.07
207 0.08
208 0.07
209 0.08
210 0.1
211 0.13
212 0.15
213 0.23
214 0.26
215 0.26
216 0.31
217 0.32
218 0.38
219 0.36
220 0.41
221 0.36
222 0.36
223 0.36
224 0.32
225 0.3
226 0.22
227 0.21
228 0.15
229 0.12
230 0.09
231 0.09
232 0.08
233 0.07
234 0.07
235 0.05
236 0.05
237 0.04
238 0.04
239 0.03
240 0.04
241 0.07
242 0.08
243 0.09
244 0.1
245 0.15
246 0.18
247 0.24
248 0.33
249 0.38
250 0.45
251 0.55
252 0.65
253 0.7
254 0.78