Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q5KMD8

Protein Details
Accession Q5KMD8   
Localization Confidence High
Confidence Score 18.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MAPPAKPASTPKRKPFTPKPPRPAEERLHydrophilic
229-248VKAPEEKNERSRPRHKLPKGBasic
NLS Segment(s)
PositionSequence
9-24STPKRKPFTPKPPRPA
235-247KNERSRPRHKLPK
302-313GGGGKNKKGKRK
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013699  Signal_recog_part_SRP72_RNA-bd  
IPR026270  SRP72  
IPR031545  SRP_TPR-like  
IPR011990  TPR-like_helical_dom_sf  
Gene Ontology GO:0005783  C:endoplasmic reticulum  
GO:0005786  C:signal recognition particle, endoplasmic reticulum targeting  
GO:0008312  F:7S RNA binding  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
KEGG cne:CNB02050  -  
Pfam View protein in Pfam  
PF08492  SRP72  
PF17004  SRP_TPR_like  
Amino Acid Sequences MAPPAKPASTPKRKPFTPKPPRPAEERLPKLYRALTDQVDDGYFENAIKTCKKILTLDASSRTAFQTLLFLHLQTDDYTSALSLLDHPSHEESLGFERAYCLYRLHREKEALEVLKGLSEKGRKIDHLEAQILYRLGEYSQAQEIYEGMLADCDVSSPEHADIVTNLSATTAHLDFDTHGYHSHLSTTVSSTSQTPMNTADLENIVPSLPTGWSSGGLAATVEKKTATVKAPEEKNERSRPRHKLPKGAVAGKEFTEDPERWIPLRQRLSYITAQSKKKGAKESMGTGFTQGSTGGHSGGSGGGGKNKKGKRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.84
3 0.84
4 0.85
5 0.86
6 0.86
7 0.87
8 0.85
9 0.82
10 0.8
11 0.79
12 0.78
13 0.75
14 0.74
15 0.67
16 0.65
17 0.61
18 0.56
19 0.48
20 0.43
21 0.41
22 0.34
23 0.32
24 0.31
25 0.28
26 0.25
27 0.24
28 0.18
29 0.14
30 0.12
31 0.1
32 0.11
33 0.11
34 0.14
35 0.15
36 0.16
37 0.19
38 0.2
39 0.23
40 0.24
41 0.28
42 0.33
43 0.37
44 0.4
45 0.42
46 0.42
47 0.4
48 0.39
49 0.34
50 0.26
51 0.21
52 0.15
53 0.15
54 0.13
55 0.16
56 0.16
57 0.15
58 0.15
59 0.15
60 0.16
61 0.12
62 0.13
63 0.1
64 0.09
65 0.09
66 0.09
67 0.08
68 0.07
69 0.07
70 0.07
71 0.09
72 0.1
73 0.1
74 0.12
75 0.14
76 0.14
77 0.14
78 0.12
79 0.11
80 0.14
81 0.16
82 0.14
83 0.12
84 0.13
85 0.14
86 0.16
87 0.15
88 0.13
89 0.15
90 0.24
91 0.3
92 0.33
93 0.36
94 0.37
95 0.36
96 0.39
97 0.42
98 0.34
99 0.28
100 0.25
101 0.21
102 0.2
103 0.2
104 0.15
105 0.12
106 0.13
107 0.14
108 0.18
109 0.19
110 0.18
111 0.23
112 0.28
113 0.29
114 0.3
115 0.3
116 0.27
117 0.26
118 0.26
119 0.21
120 0.16
121 0.12
122 0.08
123 0.07
124 0.08
125 0.08
126 0.08
127 0.1
128 0.1
129 0.1
130 0.1
131 0.1
132 0.08
133 0.08
134 0.06
135 0.04
136 0.04
137 0.04
138 0.04
139 0.04
140 0.03
141 0.03
142 0.03
143 0.04
144 0.05
145 0.05
146 0.05
147 0.05
148 0.05
149 0.05
150 0.07
151 0.07
152 0.06
153 0.06
154 0.06
155 0.06
156 0.06
157 0.08
158 0.06
159 0.06
160 0.06
161 0.06
162 0.07
163 0.08
164 0.09
165 0.07
166 0.08
167 0.09
168 0.09
169 0.09
170 0.1
171 0.09
172 0.09
173 0.09
174 0.1
175 0.1
176 0.1
177 0.11
178 0.11
179 0.12
180 0.13
181 0.13
182 0.12
183 0.12
184 0.13
185 0.14
186 0.13
187 0.12
188 0.11
189 0.11
190 0.09
191 0.08
192 0.07
193 0.06
194 0.05
195 0.05
196 0.04
197 0.05
198 0.07
199 0.07
200 0.07
201 0.08
202 0.09
203 0.08
204 0.08
205 0.07
206 0.07
207 0.09
208 0.09
209 0.09
210 0.08
211 0.09
212 0.1
213 0.14
214 0.16
215 0.19
216 0.24
217 0.32
218 0.36
219 0.43
220 0.48
221 0.51
222 0.56
223 0.61
224 0.64
225 0.66
226 0.7
227 0.73
228 0.77
229 0.82
230 0.79
231 0.79
232 0.76
233 0.77
234 0.76
235 0.73
236 0.66
237 0.59
238 0.55
239 0.45
240 0.41
241 0.31
242 0.26
243 0.25
244 0.22
245 0.23
246 0.27
247 0.28
248 0.27
249 0.34
250 0.37
251 0.41
252 0.49
253 0.45
254 0.44
255 0.45
256 0.5
257 0.49
258 0.5
259 0.51
260 0.5
261 0.53
262 0.52
263 0.57
264 0.56
265 0.58
266 0.59
267 0.54
268 0.55
269 0.56
270 0.6
271 0.59
272 0.56
273 0.5
274 0.42
275 0.38
276 0.3
277 0.24
278 0.17
279 0.1
280 0.11
281 0.12
282 0.11
283 0.09
284 0.09
285 0.09
286 0.09
287 0.1
288 0.09
289 0.1
290 0.17
291 0.2
292 0.25
293 0.33