Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G2FZQ0

Protein Details
Accession A0A0G2FZQ0   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
81-111GLAVKPERASRQQRKQRKNRMKTLRGTAKVKHydrophilic
NLS Segment(s)
PositionSequence
74-119RHRLVRVGLAVKPERASRQQRKQRKNRMKTLRGTAKVKGAKAKKDK
Subcellular Location(s) mito 12, cyto_nucl 8.5, nucl 8, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MSESITIHLRSDILHPGHAGIAKSDLCERLSQLYKASAEQVSVFGLRTHFGGGKTSGFALVYDSVEALKKFEPRHRLVRVGLAVKPERASRQQRKQRKNRMKTLRGTAKVKGAKAKKDK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.2
4 0.22
5 0.23
6 0.2
7 0.13
8 0.15
9 0.14
10 0.15
11 0.17
12 0.17
13 0.15
14 0.16
15 0.16
16 0.2
17 0.23
18 0.22
19 0.22
20 0.24
21 0.23
22 0.23
23 0.25
24 0.18
25 0.15
26 0.15
27 0.14
28 0.11
29 0.11
30 0.1
31 0.08
32 0.08
33 0.08
34 0.08
35 0.09
36 0.09
37 0.09
38 0.11
39 0.11
40 0.11
41 0.11
42 0.11
43 0.1
44 0.08
45 0.08
46 0.07
47 0.07
48 0.06
49 0.06
50 0.06
51 0.06
52 0.07
53 0.07
54 0.07
55 0.08
56 0.12
57 0.15
58 0.2
59 0.28
60 0.31
61 0.4
62 0.43
63 0.45
64 0.42
65 0.45
66 0.44
67 0.4
68 0.36
69 0.34
70 0.31
71 0.28
72 0.29
73 0.25
74 0.25
75 0.31
76 0.4
77 0.45
78 0.55
79 0.64
80 0.73
81 0.82
82 0.89
83 0.92
84 0.92
85 0.92
86 0.92
87 0.93
88 0.91
89 0.88
90 0.88
91 0.87
92 0.84
93 0.78
94 0.71
95 0.69
96 0.66
97 0.62
98 0.6
99 0.57