Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G2G0P7

Protein Details
Accession A0A0G2G0P7   
Localization Confidence High
Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MPSPLSKPRLRRRKAEPSPGLSHydrophilic
27-55QNEPLRYRIKKRAPPRGPNKRRRSDDDDMBasic
NLS Segment(s)
PositionSequence
7-16KPRLRRRKAE
32-49RYRIKKRAPPRGPNKRRR
Subcellular Location(s) nucl 18, mito_nucl 13.833, cyto_nucl 9.833, mito 8.5
Family & Domain DBs
Gene Ontology GO:0003677  F:DNA binding  
Amino Acid Sequences MPSPLSKPRLRRRKAEPSPGLSSSLAQNEPLRYRIKKRAPPRGPNKRRRSDDDDMGRDDDESYGSDAHHGKENVNIFDMNNETKRDPGMFIFKGYSDKSSEAAPSTPKRQRIAPPDVPRGLTKEDFHKLGAPDAVEKETSVGTNVEVGERGDQWSMEDDHKLVEVVLEKVKNMDLSSEVQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.85
3 0.82
4 0.79
5 0.79
6 0.72
7 0.65
8 0.54
9 0.45
10 0.38
11 0.33
12 0.27
13 0.22
14 0.23
15 0.24
16 0.26
17 0.29
18 0.32
19 0.32
20 0.39
21 0.47
22 0.55
23 0.59
24 0.67
25 0.75
26 0.79
27 0.84
28 0.88
29 0.89
30 0.9
31 0.92
32 0.92
33 0.91
34 0.88
35 0.86
36 0.84
37 0.79
38 0.78
39 0.76
40 0.7
41 0.62
42 0.56
43 0.48
44 0.39
45 0.32
46 0.22
47 0.14
48 0.1
49 0.09
50 0.08
51 0.07
52 0.1
53 0.11
54 0.11
55 0.16
56 0.16
57 0.15
58 0.19
59 0.22
60 0.19
61 0.19
62 0.19
63 0.13
64 0.14
65 0.16
66 0.14
67 0.13
68 0.14
69 0.13
70 0.13
71 0.14
72 0.13
73 0.12
74 0.12
75 0.16
76 0.14
77 0.15
78 0.15
79 0.15
80 0.17
81 0.16
82 0.16
83 0.13
84 0.13
85 0.13
86 0.13
87 0.13
88 0.12
89 0.13
90 0.16
91 0.17
92 0.24
93 0.28
94 0.32
95 0.33
96 0.37
97 0.43
98 0.47
99 0.53
100 0.54
101 0.57
102 0.6
103 0.6
104 0.56
105 0.5
106 0.45
107 0.4
108 0.33
109 0.27
110 0.26
111 0.28
112 0.28
113 0.28
114 0.28
115 0.25
116 0.24
117 0.24
118 0.18
119 0.17
120 0.18
121 0.18
122 0.14
123 0.14
124 0.12
125 0.11
126 0.11
127 0.1
128 0.09
129 0.08
130 0.1
131 0.1
132 0.09
133 0.1
134 0.1
135 0.1
136 0.11
137 0.12
138 0.11
139 0.1
140 0.11
141 0.14
142 0.16
143 0.16
144 0.17
145 0.15
146 0.16
147 0.16
148 0.15
149 0.12
150 0.11
151 0.12
152 0.13
153 0.18
154 0.18
155 0.18
156 0.19
157 0.21
158 0.2
159 0.18
160 0.17