Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G2HFN3

Protein Details
Accession A0A0G2HFN3    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
88-109AEVLSKKDKREKERGNDGKKNGBasic
NLS Segment(s)
PositionSequence
93-109KKDKREKERGNDGKKNG
Subcellular Location(s) cyto 11, cyto_nucl 8.5, mito 8, nucl 4, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR038814  AIM11  
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MFQPSHHGPVIPPRGQKDKGDDAFVAVEALGLATLNVFSFGVMMTGGFMWAFDISNIEDLRRKARASLYGVDGVVDQAAEQQVEEWIAEVLSKKDKREKERGNDGKKNG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.52
3 0.54
4 0.51
5 0.53
6 0.5
7 0.49
8 0.43
9 0.37
10 0.34
11 0.3
12 0.23
13 0.12
14 0.1
15 0.06
16 0.06
17 0.04
18 0.03
19 0.03
20 0.02
21 0.03
22 0.02
23 0.03
24 0.03
25 0.03
26 0.03
27 0.03
28 0.04
29 0.03
30 0.03
31 0.03
32 0.03
33 0.03
34 0.03
35 0.03
36 0.03
37 0.03
38 0.04
39 0.03
40 0.04
41 0.04
42 0.07
43 0.07
44 0.07
45 0.1
46 0.11
47 0.14
48 0.16
49 0.16
50 0.15
51 0.18
52 0.23
53 0.24
54 0.26
55 0.26
56 0.26
57 0.25
58 0.23
59 0.21
60 0.15
61 0.11
62 0.08
63 0.05
64 0.04
65 0.05
66 0.05
67 0.05
68 0.05
69 0.05
70 0.06
71 0.06
72 0.05
73 0.05
74 0.05
75 0.06
76 0.07
77 0.09
78 0.18
79 0.21
80 0.25
81 0.34
82 0.43
83 0.51
84 0.6
85 0.68
86 0.69
87 0.78
88 0.84
89 0.86