Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P0CO24

Protein Details
Accession P0CO24    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
9-35SKKSTASDAKKRTKKDPNKPKRALSAYHydrophilic
NLS Segment(s)
PositionSequence
15-30SDAKKRTKKDPNKPKR
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005694  C:chromosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0006281  P:DNA repair  
KEGG cne:CNF04730  -  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKVSTKDSKKSTASDAKKRTKKDPNKPKRALSAYMFFVQDYRERIKTENPEATFGDVGKLLGIKWREMNENEKKPYEAKAKADKERADRENADYKAEGKASKKAAKADEESDDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.64
3 0.69
4 0.72
5 0.76
6 0.77
7 0.78
8 0.79
9 0.81
10 0.82
11 0.83
12 0.83
13 0.87
14 0.89
15 0.85
16 0.84
17 0.78
18 0.72
19 0.65
20 0.59
21 0.51
22 0.46
23 0.4
24 0.3
25 0.25
26 0.21
27 0.19
28 0.18
29 0.19
30 0.19
31 0.19
32 0.21
33 0.27
34 0.32
35 0.35
36 0.38
37 0.34
38 0.35
39 0.34
40 0.34
41 0.28
42 0.22
43 0.16
44 0.1
45 0.09
46 0.06
47 0.06
48 0.04
49 0.08
50 0.08
51 0.09
52 0.11
53 0.13
54 0.16
55 0.18
56 0.27
57 0.33
58 0.39
59 0.42
60 0.41
61 0.4
62 0.38
63 0.43
64 0.42
65 0.37
66 0.37
67 0.44
68 0.5
69 0.56
70 0.61
71 0.6
72 0.59
73 0.63
74 0.59
75 0.55
76 0.5
77 0.49
78 0.51
79 0.47
80 0.43
81 0.35
82 0.33
83 0.3
84 0.31
85 0.28
86 0.22
87 0.28
88 0.33
89 0.38
90 0.41
91 0.44
92 0.47
93 0.5
94 0.52
95 0.49
96 0.47