Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0S2LIW7

Protein Details
Accession A0A0S2LIW7   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
234-265EKEKAKQEKLEARRKKEERRRQRAEEMEKEKABasic
NLS Segment(s)
PositionSequence
111-124REKEKEEKSKVKRK
230-265AKKEEKEKAKQEKLEARRKKEERRRQRAEEMEKEKA
Subcellular Location(s) mito 21.5, cyto_mito 12.5, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036788  T_IF-3_C_sf  
IPR001288  Translation_initiation_fac_3  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0043022  F:ribosome binding  
GO:0003743  F:translation initiation factor activity  
GO:0070124  P:mitochondrial translational initiation  
GO:0032790  P:ribosome disassembly  
Amino Acid Sequences MLVLRPPMTLRAISHARLIPIPIPPILSRPASSGPPRPRQTQPAAHPLSYRDSSIPHSVVRLIGPEGLLPPQRLSSILSTYSTSTHTLTLVSVDGEYPVVKLVSKAEERDREKEKEEKSKVKRKISMEEKEVQVSWQSAKGDLGHKLEMAKGILEKGDRVQVVFANRRRAEPVSERQKDEIVAMFQGILEEVGKKWKEDDKNRGLWVLYYNPLDSVRQEVEKKVLEAEQAKKEEKEKAKQEKLEARRKKEERRRQRAEEMEKEKAEEAARRDEEYQRRIANSRKSGFGGWR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.34
3 0.33
4 0.32
5 0.33
6 0.28
7 0.27
8 0.28
9 0.22
10 0.23
11 0.21
12 0.23
13 0.25
14 0.25
15 0.22
16 0.24
17 0.26
18 0.3
19 0.34
20 0.41
21 0.46
22 0.54
23 0.58
24 0.6
25 0.63
26 0.65
27 0.68
28 0.68
29 0.65
30 0.65
31 0.65
32 0.61
33 0.56
34 0.5
35 0.48
36 0.4
37 0.35
38 0.25
39 0.23
40 0.26
41 0.3
42 0.29
43 0.23
44 0.23
45 0.22
46 0.22
47 0.2
48 0.18
49 0.13
50 0.12
51 0.12
52 0.11
53 0.11
54 0.13
55 0.15
56 0.14
57 0.14
58 0.14
59 0.14
60 0.14
61 0.16
62 0.15
63 0.16
64 0.17
65 0.17
66 0.17
67 0.18
68 0.18
69 0.17
70 0.16
71 0.14
72 0.13
73 0.12
74 0.12
75 0.11
76 0.1
77 0.09
78 0.08
79 0.07
80 0.06
81 0.06
82 0.06
83 0.06
84 0.05
85 0.05
86 0.05
87 0.05
88 0.06
89 0.07
90 0.12
91 0.13
92 0.16
93 0.22
94 0.3
95 0.34
96 0.4
97 0.44
98 0.42
99 0.44
100 0.48
101 0.48
102 0.5
103 0.53
104 0.57
105 0.6
106 0.67
107 0.72
108 0.73
109 0.74
110 0.67
111 0.7
112 0.7
113 0.67
114 0.62
115 0.58
116 0.51
117 0.46
118 0.42
119 0.32
120 0.23
121 0.18
122 0.14
123 0.12
124 0.11
125 0.1
126 0.11
127 0.12
128 0.14
129 0.16
130 0.17
131 0.14
132 0.14
133 0.14
134 0.14
135 0.13
136 0.11
137 0.08
138 0.07
139 0.07
140 0.07
141 0.07
142 0.07
143 0.07
144 0.1
145 0.1
146 0.09
147 0.1
148 0.11
149 0.16
150 0.23
151 0.25
152 0.31
153 0.32
154 0.33
155 0.35
156 0.35
157 0.35
158 0.34
159 0.4
160 0.42
161 0.45
162 0.46
163 0.45
164 0.44
165 0.4
166 0.34
167 0.26
168 0.16
169 0.13
170 0.11
171 0.09
172 0.08
173 0.08
174 0.06
175 0.05
176 0.04
177 0.04
178 0.05
179 0.11
180 0.12
181 0.12
182 0.15
183 0.22
184 0.31
185 0.39
186 0.49
187 0.5
188 0.56
189 0.57
190 0.56
191 0.49
192 0.41
193 0.35
194 0.29
195 0.24
196 0.19
197 0.18
198 0.18
199 0.19
200 0.18
201 0.16
202 0.17
203 0.16
204 0.19
205 0.21
206 0.21
207 0.25
208 0.26
209 0.26
210 0.24
211 0.23
212 0.22
213 0.27
214 0.31
215 0.33
216 0.36
217 0.38
218 0.38
219 0.4
220 0.45
221 0.47
222 0.5
223 0.53
224 0.6
225 0.66
226 0.69
227 0.74
228 0.75
229 0.77
230 0.78
231 0.77
232 0.75
233 0.77
234 0.81
235 0.84
236 0.85
237 0.86
238 0.87
239 0.89
240 0.9
241 0.87
242 0.89
243 0.88
244 0.87
245 0.86
246 0.82
247 0.79
248 0.7
249 0.64
250 0.54
251 0.47
252 0.4
253 0.35
254 0.32
255 0.34
256 0.35
257 0.35
258 0.38
259 0.44
260 0.49
261 0.49
262 0.52
263 0.47
264 0.49
265 0.52
266 0.57
267 0.59
268 0.6
269 0.59
270 0.56
271 0.55