Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q5KPZ7

Protein Details
Accession Q5KPZ7    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
85-109MGAFYQPSQRKRKNKHGFLSRLKGGHydrophilic
NLS Segment(s)
PositionSequence
94-125RKRKNKHGFLSRLKGGKNGRKTLLRRLLKGRK
Subcellular Location(s) mito 19, mito_nucl 13.166, cyto_mito 10.666, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG cne:CNA01000  -  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MPRLARVLAVPLPPRARLAPLSLPRATLSAPAPAPQSSILSSLRTPTSTFVASRPMALSSPPIPTHILPSLPAFSPLGALRHVAMGAFYQPSQRKRKNKHGFLSRLKGGKNGRKTLLRRLLKGRKFLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.3
3 0.3
4 0.27
5 0.3
6 0.33
7 0.36
8 0.41
9 0.39
10 0.39
11 0.36
12 0.35
13 0.3
14 0.23
15 0.18
16 0.17
17 0.17
18 0.17
19 0.19
20 0.18
21 0.18
22 0.16
23 0.16
24 0.12
25 0.15
26 0.15
27 0.14
28 0.15
29 0.16
30 0.16
31 0.15
32 0.15
33 0.14
34 0.15
35 0.15
36 0.15
37 0.14
38 0.18
39 0.17
40 0.17
41 0.16
42 0.14
43 0.13
44 0.13
45 0.14
46 0.1
47 0.13
48 0.12
49 0.13
50 0.14
51 0.14
52 0.17
53 0.15
54 0.14
55 0.12
56 0.13
57 0.13
58 0.12
59 0.13
60 0.1
61 0.09
62 0.1
63 0.1
64 0.1
65 0.09
66 0.09
67 0.08
68 0.08
69 0.08
70 0.06
71 0.06
72 0.05
73 0.06
74 0.07
75 0.07
76 0.12
77 0.18
78 0.25
79 0.35
80 0.44
81 0.53
82 0.61
83 0.73
84 0.78
85 0.82
86 0.85
87 0.86
88 0.86
89 0.86
90 0.85
91 0.8
92 0.73
93 0.64
94 0.61
95 0.6
96 0.59
97 0.59
98 0.58
99 0.58
100 0.62
101 0.65
102 0.69
103 0.71
104 0.68
105 0.66
106 0.7
107 0.74
108 0.72
109 0.77