Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0G2FV57

Protein Details
Accession A0A0G2FV57    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
46-71YIHFATLKPEQKKKKEPKGGKGGAKKBasic
NLS Segment(s)
PositionSequence
55-71EQKKKKEPKGGKGGAKK
Subcellular Location(s) cyto 8, extr 7, plas 5, E.R. 4, cyto_pero 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAQFDWFSKIGATPQAVAVLNDQPYLFTILVVVLLILILQGVFIWYIHFATLKPEQKKKKEPKGGKGGAKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.18
3 0.18
4 0.17
5 0.17
6 0.16
7 0.15
8 0.15
9 0.14
10 0.11
11 0.11
12 0.14
13 0.12
14 0.08
15 0.08
16 0.07
17 0.07
18 0.07
19 0.06
20 0.02
21 0.02
22 0.02
23 0.02
24 0.02
25 0.01
26 0.01
27 0.01
28 0.02
29 0.02
30 0.02
31 0.03
32 0.04
33 0.04
34 0.05
35 0.05
36 0.05
37 0.1
38 0.19
39 0.26
40 0.33
41 0.42
42 0.51
43 0.61
44 0.72
45 0.78
46 0.81
47 0.84
48 0.86
49 0.88
50 0.9
51 0.9