Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G2F8H6

Protein Details
Accession A0A0G2F8H6    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
100-128PEDAARKLEKTKKRQQHFPQRKYAIKVRLHydrophilic
NLS Segment(s)
PositionSequence
87-121RPKQTRAIRRRLSPEDAARKLEKTKKRQQHFPQRK
Subcellular Location(s) nucl 19, cyto_nucl 11.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MSQSSSKIKAGQLWSKNKDELTKTLGELKTELGQLRIQKIASSGTKLNKIHDLRKSIARVLTIINAKERHHLRLFYKNKKYLPLDLRPKQTRAIRRRLSPEDAARKLEKTKKRQQHFPQRKYAIKVRLH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.6
3 0.61
4 0.57
5 0.55
6 0.5
7 0.45
8 0.4
9 0.37
10 0.33
11 0.39
12 0.37
13 0.32
14 0.28
15 0.26
16 0.23
17 0.23
18 0.22
19 0.16
20 0.18
21 0.19
22 0.21
23 0.21
24 0.18
25 0.17
26 0.17
27 0.2
28 0.19
29 0.19
30 0.21
31 0.23
32 0.3
33 0.3
34 0.31
35 0.35
36 0.37
37 0.39
38 0.41
39 0.42
40 0.37
41 0.42
42 0.42
43 0.36
44 0.34
45 0.28
46 0.24
47 0.2
48 0.21
49 0.18
50 0.16
51 0.17
52 0.18
53 0.18
54 0.23
55 0.24
56 0.25
57 0.25
58 0.29
59 0.29
60 0.38
61 0.46
62 0.5
63 0.57
64 0.58
65 0.58
66 0.61
67 0.6
68 0.58
69 0.56
70 0.56
71 0.58
72 0.58
73 0.66
74 0.63
75 0.62
76 0.6
77 0.6
78 0.61
79 0.59
80 0.63
81 0.61
82 0.64
83 0.7
84 0.7
85 0.69
86 0.65
87 0.66
88 0.65
89 0.62
90 0.6
91 0.53
92 0.5
93 0.52
94 0.54
95 0.54
96 0.54
97 0.61
98 0.67
99 0.73
100 0.81
101 0.84
102 0.87
103 0.89
104 0.88
105 0.88
106 0.87
107 0.86
108 0.82
109 0.8