Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G2FSL4

Protein Details
Accession A0A0G2FSL4    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
33-63ADPKPKSNLRDQKRKDERPAKRKRSENDSKDBasic
72-99HEPKNRPAKPSKKTPKESKTPKDKKAELBasic
NLS Segment(s)
PositionSequence
36-96KPKSNLRDQKRKDERPAKRKRSENDSKDANPNKRQAHEPKNRPAKPSKKTPKESKTPKDKK
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MGKKRTKAQNGAKPVFDEAALSKLTARIDTDLADPKPKSNLRDQKRKDERPAKRKRSENDSKDANPNKRQAHEPKNRPAKPSKKTPKESKTPKDKKAELLQEILALGGDENDLDIIAGVDSDVEEGQEPRPKDAPVEMDKALKNELANFAAGLGFEKVRDEDAATDDEEGDAEEESEAAEEAGEDEWEDKPVPEQVAKEPAAEEPSRSAADIRAKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.48
3 0.37
4 0.29
5 0.2
6 0.18
7 0.16
8 0.14
9 0.13
10 0.14
11 0.15
12 0.14
13 0.15
14 0.14
15 0.14
16 0.16
17 0.19
18 0.23
19 0.24
20 0.29
21 0.28
22 0.28
23 0.35
24 0.38
25 0.38
26 0.42
27 0.51
28 0.54
29 0.65
30 0.69
31 0.72
32 0.79
33 0.83
34 0.83
35 0.84
36 0.85
37 0.85
38 0.9
39 0.9
40 0.88
41 0.88
42 0.83
43 0.83
44 0.83
45 0.78
46 0.75
47 0.71
48 0.66
49 0.67
50 0.69
51 0.66
52 0.61
53 0.62
54 0.59
55 0.54
56 0.58
57 0.58
58 0.61
59 0.64
60 0.66
61 0.69
62 0.75
63 0.75
64 0.73
65 0.73
66 0.72
67 0.68
68 0.71
69 0.72
70 0.71
71 0.77
72 0.82
73 0.8
74 0.81
75 0.85
76 0.84
77 0.84
78 0.83
79 0.82
80 0.8
81 0.74
82 0.7
83 0.68
84 0.65
85 0.55
86 0.48
87 0.4
88 0.32
89 0.29
90 0.23
91 0.14
92 0.07
93 0.05
94 0.03
95 0.03
96 0.02
97 0.02
98 0.02
99 0.02
100 0.02
101 0.02
102 0.02
103 0.02
104 0.02
105 0.02
106 0.02
107 0.02
108 0.03
109 0.03
110 0.03
111 0.03
112 0.04
113 0.06
114 0.11
115 0.11
116 0.13
117 0.15
118 0.15
119 0.16
120 0.18
121 0.22
122 0.22
123 0.26
124 0.24
125 0.26
126 0.27
127 0.27
128 0.26
129 0.21
130 0.17
131 0.15
132 0.16
133 0.13
134 0.12
135 0.11
136 0.1
137 0.09
138 0.09
139 0.08
140 0.07
141 0.06
142 0.06
143 0.07
144 0.07
145 0.08
146 0.09
147 0.09
148 0.09
149 0.11
150 0.12
151 0.12
152 0.12
153 0.11
154 0.1
155 0.1
156 0.09
157 0.07
158 0.05
159 0.05
160 0.05
161 0.04
162 0.04
163 0.05
164 0.04
165 0.04
166 0.04
167 0.03
168 0.04
169 0.05
170 0.05
171 0.05
172 0.06
173 0.07
174 0.08
175 0.09
176 0.09
177 0.1
178 0.14
179 0.16
180 0.18
181 0.2
182 0.23
183 0.3
184 0.31
185 0.3
186 0.27
187 0.27
188 0.3
189 0.28
190 0.25
191 0.2
192 0.23
193 0.23
194 0.23
195 0.22
196 0.22