Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G2FKI5

Protein Details
Accession A0A0G2FKI5   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MRSADKKTEKTKKGKKAWDRAEKWAERBasic
NLS Segment(s)
PositionSequence
6-75KKTEKTKKGKKAWDRAEKWAEREPEREPERERQAVKAKGRQPRKDERPAWLKQKQALKQKFPEGWRPPKR
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR010487  NGRN/Rrg9  
Gene Ontology GO:0005739  C:mitochondrion  
Pfam View protein in Pfam  
PF06413  Neugrin  
Amino Acid Sequences MRSADKKTEKTKKGKKAWDRAEKWAEREPEREPERERQAVKAKGRQPRKDERPAWLKQKQALKQKFPEGWRPPKRLSPDALEGIRVLHQQFPDMYTTEALAEKFEVSPEAIRRILRAKWEPTAEEEEDRQRRWFNRGVSVWQRYAELGRQPPRRWREAGVPASPWEGAPSREKDHGEEEDADKIDPETISRLQAQMKLAKSLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.89
3 0.9
4 0.91
5 0.91
6 0.86
7 0.85
8 0.85
9 0.78
10 0.72
11 0.69
12 0.65
13 0.57
14 0.56
15 0.5
16 0.5
17 0.49
18 0.49
19 0.46
20 0.49
21 0.53
22 0.57
23 0.54
24 0.52
25 0.57
26 0.6
27 0.62
28 0.62
29 0.61
30 0.64
31 0.72
32 0.73
33 0.72
34 0.74
35 0.76
36 0.78
37 0.75
38 0.74
39 0.73
40 0.72
41 0.73
42 0.68
43 0.63
44 0.58
45 0.63
46 0.62
47 0.64
48 0.65
49 0.63
50 0.63
51 0.66
52 0.66
53 0.6
54 0.63
55 0.61
56 0.64
57 0.66
58 0.66
59 0.62
60 0.62
61 0.65
62 0.59
63 0.53
64 0.48
65 0.44
66 0.42
67 0.39
68 0.33
69 0.27
70 0.23
71 0.21
72 0.17
73 0.13
74 0.11
75 0.1
76 0.11
77 0.11
78 0.11
79 0.11
80 0.11
81 0.11
82 0.08
83 0.09
84 0.08
85 0.09
86 0.08
87 0.07
88 0.06
89 0.06
90 0.06
91 0.06
92 0.06
93 0.05
94 0.07
95 0.08
96 0.11
97 0.12
98 0.12
99 0.14
100 0.16
101 0.18
102 0.22
103 0.26
104 0.26
105 0.28
106 0.3
107 0.29
108 0.3
109 0.33
110 0.28
111 0.25
112 0.24
113 0.28
114 0.3
115 0.31
116 0.29
117 0.28
118 0.29
119 0.33
120 0.37
121 0.31
122 0.37
123 0.37
124 0.43
125 0.47
126 0.49
127 0.46
128 0.4
129 0.38
130 0.3
131 0.3
132 0.26
133 0.24
134 0.27
135 0.34
136 0.41
137 0.44
138 0.53
139 0.57
140 0.59
141 0.56
142 0.52
143 0.52
144 0.55
145 0.58
146 0.51
147 0.48
148 0.43
149 0.42
150 0.38
151 0.29
152 0.22
153 0.17
154 0.17
155 0.21
156 0.24
157 0.27
158 0.32
159 0.33
160 0.33
161 0.37
162 0.38
163 0.36
164 0.34
165 0.32
166 0.32
167 0.31
168 0.28
169 0.23
170 0.21
171 0.19
172 0.15
173 0.14
174 0.14
175 0.15
176 0.18
177 0.19
178 0.22
179 0.23
180 0.27
181 0.31
182 0.32
183 0.33