Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q5KB96

Protein Details
Accession Q5KB96    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
158-184REKAREKMGLKTKSKKRGKKGAKKATABasic
NLS Segment(s)
PositionSequence
146-184KAKRDQERREEAREKAREKMGLKTKSKKRGKKGAKKATA
Subcellular Location(s) nucl 12, mito 6, plas 6, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR032858  CcoP_N  
Gene Ontology GO:0016020  C:membrane  
KEGG cne:CNI03310  -  
Pfam View protein in Pfam  
PF14715  FixP_N  
Amino Acid Sequences MSSNSYQPIPSQSPPVSRSNSPSTSQTTFPPRPNHPFGDEDEEYQERLRGYQAEFNRPPPAWWKRMFLILAIIAMGWLSIYLGKRGMSKKPQVIYASRYSEEFKYRPAASPVITETLSDGRIRIRGASVGGVGVREEDIPLTPAMKAKRDQERREEAREKAREKMGLKTKSKKRGKKGAKKATA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.48
3 0.46
4 0.44
5 0.48
6 0.48
7 0.48
8 0.45
9 0.45
10 0.44
11 0.42
12 0.41
13 0.4
14 0.42
15 0.44
16 0.48
17 0.51
18 0.52
19 0.57
20 0.61
21 0.6
22 0.54
23 0.51
24 0.48
25 0.49
26 0.43
27 0.36
28 0.35
29 0.31
30 0.28
31 0.26
32 0.24
33 0.15
34 0.15
35 0.15
36 0.13
37 0.14
38 0.2
39 0.24
40 0.32
41 0.33
42 0.35
43 0.39
44 0.36
45 0.35
46 0.37
47 0.4
48 0.37
49 0.38
50 0.39
51 0.36
52 0.4
53 0.39
54 0.3
55 0.26
56 0.19
57 0.17
58 0.12
59 0.11
60 0.06
61 0.05
62 0.05
63 0.02
64 0.02
65 0.02
66 0.04
67 0.04
68 0.05
69 0.06
70 0.07
71 0.11
72 0.14
73 0.2
74 0.24
75 0.3
76 0.34
77 0.34
78 0.38
79 0.36
80 0.36
81 0.35
82 0.35
83 0.33
84 0.28
85 0.28
86 0.26
87 0.25
88 0.27
89 0.23
90 0.2
91 0.21
92 0.22
93 0.23
94 0.23
95 0.23
96 0.19
97 0.2
98 0.2
99 0.17
100 0.16
101 0.14
102 0.13
103 0.13
104 0.13
105 0.11
106 0.1
107 0.09
108 0.11
109 0.11
110 0.1
111 0.1
112 0.1
113 0.11
114 0.11
115 0.1
116 0.09
117 0.09
118 0.08
119 0.07
120 0.06
121 0.06
122 0.05
123 0.05
124 0.05
125 0.06
126 0.07
127 0.07
128 0.08
129 0.08
130 0.12
131 0.15
132 0.18
133 0.22
134 0.28
135 0.39
136 0.48
137 0.54
138 0.59
139 0.67
140 0.69
141 0.74
142 0.73
143 0.68
144 0.68
145 0.71
146 0.64
147 0.6
148 0.6
149 0.57
150 0.53
151 0.57
152 0.56
153 0.58
154 0.63
155 0.67
156 0.71
157 0.76
158 0.84
159 0.84
160 0.85
161 0.86
162 0.89
163 0.9
164 0.92