Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q5KFN5

Protein Details
Accession Q5KFN5    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
100-126SPPSAFIRPPKPPKKFRGWGPKIQHGVHydrophilic
NLS Segment(s)
PositionSequence
107-121RPPKPPKKFRGWGPK
Subcellular Location(s) mito 22.5, mito_nucl 13, nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039603  Fyv4  
IPR019083  IGR_protein_motif  
Gene Ontology GO:0005739  C:mitochondrion  
Pfam View protein in Pfam  
PF09597  IGR  
Amino Acid Sequences MMFLPSLRASSSRLAQPRLFSTTSRVLQKAPLAASPEAATPEELLGKIGRNADKKLTPFAESWDKLNEVWLKTKKMNDLGLATKEKRYILWAFSRYSQGSPPSAFIRPPKPPKKFRGWGPKIQHGVRVRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.39
3 0.41
4 0.43
5 0.43
6 0.41
7 0.34
8 0.34
9 0.37
10 0.4
11 0.41
12 0.38
13 0.33
14 0.35
15 0.37
16 0.34
17 0.27
18 0.25
19 0.24
20 0.23
21 0.23
22 0.2
23 0.18
24 0.16
25 0.15
26 0.13
27 0.09
28 0.09
29 0.09
30 0.08
31 0.08
32 0.07
33 0.08
34 0.09
35 0.13
36 0.16
37 0.18
38 0.2
39 0.23
40 0.26
41 0.26
42 0.29
43 0.27
44 0.25
45 0.23
46 0.25
47 0.29
48 0.26
49 0.26
50 0.23
51 0.23
52 0.2
53 0.24
54 0.23
55 0.16
56 0.23
57 0.25
58 0.26
59 0.28
60 0.31
61 0.31
62 0.32
63 0.32
64 0.27
65 0.27
66 0.27
67 0.29
68 0.31
69 0.28
70 0.26
71 0.26
72 0.24
73 0.21
74 0.22
75 0.2
76 0.2
77 0.26
78 0.27
79 0.27
80 0.29
81 0.34
82 0.31
83 0.3
84 0.29
85 0.25
86 0.25
87 0.24
88 0.25
89 0.24
90 0.24
91 0.26
92 0.29
93 0.33
94 0.4
95 0.5
96 0.58
97 0.64
98 0.71
99 0.77
100 0.81
101 0.82
102 0.82
103 0.83
104 0.8
105 0.81
106 0.8
107 0.82
108 0.79
109 0.73
110 0.71