Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G2H2F2

Protein Details
Accession A0A0G2H2F2    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
76-97EPKKGNPEPKSDSKKKKETEEDBasic
NLS Segment(s)
PositionSequence
75-92NEPKKGNPEPKSDSKKKK
Subcellular Location(s) nucl 25, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MPSSKGEPTDPELREELKEGKCFSLMPQSRIMTHQTNIARQRSSRSRTSREGASKLAKEYEKQGGGYENEPGSKNEPKKGNPEPKSDSKKKKETEED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.33
3 0.34
4 0.3
5 0.33
6 0.31
7 0.3
8 0.28
9 0.28
10 0.26
11 0.3
12 0.28
13 0.27
14 0.31
15 0.31
16 0.32
17 0.33
18 0.36
19 0.28
20 0.25
21 0.29
22 0.25
23 0.3
24 0.35
25 0.36
26 0.33
27 0.31
28 0.37
29 0.39
30 0.41
31 0.44
32 0.45
33 0.47
34 0.51
35 0.53
36 0.52
37 0.49
38 0.47
39 0.42
40 0.4
41 0.36
42 0.32
43 0.33
44 0.28
45 0.24
46 0.25
47 0.27
48 0.24
49 0.23
50 0.22
51 0.21
52 0.22
53 0.22
54 0.22
55 0.17
56 0.17
57 0.18
58 0.19
59 0.2
60 0.27
61 0.29
62 0.33
63 0.39
64 0.41
65 0.48
66 0.57
67 0.63
68 0.61
69 0.66
70 0.67
71 0.71
72 0.78
73 0.79
74 0.8
75 0.79
76 0.83
77 0.82