Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G2HW47

Protein Details
Accession A0A0G2HW47    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
40-65QTPPLSSQPAPPPRRRRPRWVSAAVFHydrophilic
NLS Segment(s)
PositionSequence
53-56RRRR
Subcellular Location(s) mito 13, cyto 6, nucl 3, plas 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR029069  HotDog_dom_sf  
IPR006683  Thioestr_dom  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF03061  4HBT  
CDD cd03443  PaaI_thioesterase  
Amino Acid Sequences MSRQPPAATRTPRHPHSFSTSSRLLIDQQAPSATAPGAPQTPPLSSQPAPPPRRRRPRWVSAAVFLLLGLAAGTAARAVLAPPPPLVPGTDVDESLTRDIRAAAAQLPVVRRLLSDPGWSSFHHEAYAGVPAEARPRRITTGPLAGSRGVGAYQHVFHSAATGEVVAVVYLGTGTVGWPGVVHGGAIATLLDEHSARAALRDLAAGGGAGLLTASLDIAYKRPTLSSDFYVLRARAVPEEALAPEERGKRGRKVWVDATVETVDGKTCVECRALFVSPKSVKLRRVPENF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.63
3 0.63
4 0.65
5 0.58
6 0.56
7 0.52
8 0.46
9 0.44
10 0.39
11 0.33
12 0.32
13 0.33
14 0.27
15 0.26
16 0.25
17 0.25
18 0.23
19 0.22
20 0.16
21 0.12
22 0.11
23 0.12
24 0.14
25 0.13
26 0.16
27 0.17
28 0.18
29 0.2
30 0.22
31 0.26
32 0.24
33 0.31
34 0.37
35 0.45
36 0.52
37 0.59
38 0.67
39 0.71
40 0.82
41 0.82
42 0.83
43 0.83
44 0.86
45 0.86
46 0.84
47 0.78
48 0.7
49 0.66
50 0.55
51 0.45
52 0.34
53 0.24
54 0.14
55 0.1
56 0.06
57 0.03
58 0.02
59 0.02
60 0.02
61 0.02
62 0.02
63 0.02
64 0.02
65 0.03
66 0.07
67 0.09
68 0.1
69 0.11
70 0.11
71 0.12
72 0.13
73 0.13
74 0.11
75 0.11
76 0.15
77 0.15
78 0.14
79 0.15
80 0.16
81 0.16
82 0.16
83 0.15
84 0.11
85 0.1
86 0.1
87 0.1
88 0.09
89 0.09
90 0.09
91 0.08
92 0.09
93 0.11
94 0.12
95 0.12
96 0.12
97 0.11
98 0.1
99 0.11
100 0.13
101 0.13
102 0.15
103 0.15
104 0.17
105 0.19
106 0.18
107 0.23
108 0.21
109 0.21
110 0.18
111 0.17
112 0.15
113 0.13
114 0.17
115 0.11
116 0.09
117 0.09
118 0.09
119 0.16
120 0.17
121 0.18
122 0.16
123 0.17
124 0.2
125 0.21
126 0.23
127 0.19
128 0.24
129 0.24
130 0.23
131 0.23
132 0.2
133 0.19
134 0.17
135 0.14
136 0.07
137 0.06
138 0.06
139 0.06
140 0.06
141 0.07
142 0.07
143 0.08
144 0.07
145 0.08
146 0.07
147 0.06
148 0.06
149 0.05
150 0.04
151 0.04
152 0.04
153 0.03
154 0.03
155 0.02
156 0.02
157 0.02
158 0.02
159 0.02
160 0.02
161 0.02
162 0.03
163 0.03
164 0.03
165 0.03
166 0.03
167 0.04
168 0.04
169 0.04
170 0.03
171 0.03
172 0.03
173 0.03
174 0.03
175 0.02
176 0.03
177 0.03
178 0.03
179 0.04
180 0.04
181 0.04
182 0.05
183 0.05
184 0.06
185 0.07
186 0.07
187 0.07
188 0.07
189 0.07
190 0.07
191 0.07
192 0.06
193 0.04
194 0.04
195 0.03
196 0.03
197 0.02
198 0.02
199 0.02
200 0.02
201 0.02
202 0.02
203 0.03
204 0.04
205 0.06
206 0.08
207 0.09
208 0.1
209 0.1
210 0.13
211 0.17
212 0.21
213 0.22
214 0.25
215 0.26
216 0.28
217 0.32
218 0.3
219 0.27
220 0.25
221 0.23
222 0.19
223 0.2
224 0.18
225 0.14
226 0.15
227 0.14
228 0.15
229 0.14
230 0.14
231 0.17
232 0.2
233 0.23
234 0.28
235 0.32
236 0.36
237 0.42
238 0.5
239 0.51
240 0.55
241 0.59
242 0.61
243 0.61
244 0.55
245 0.53
246 0.44
247 0.38
248 0.31
249 0.25
250 0.16
251 0.12
252 0.12
253 0.09
254 0.1
255 0.12
256 0.14
257 0.14
258 0.17
259 0.22
260 0.25
261 0.28
262 0.29
263 0.37
264 0.37
265 0.44
266 0.49
267 0.49
268 0.53
269 0.58
270 0.65