Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q5KLG4

Protein Details
Accession Q5KLG4    Localization Confidence High Confidence Score 20.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MPRVTKKQKESGKAPKPKPRARSAPNASHydrophilic
NLS Segment(s)
PositionSequence
6-68KKQKESGKAPKPKPRARSAPNASAKQGFKTAPSRAPKDAYLGKAKKIKTDLIQRAKVKKQYAK
83-115GSRRRNEREESDNKLKGKTGSFKGKERREREER
159-198RKSRVEEAPPKPKVRALSPSPPPSAPSSEPKPSLRTLKKE
Subcellular Location(s) nucl 22, cyto 3
Family & Domain DBs
KEGG cne:CNB05370  -  
Amino Acid Sequences MPRVTKKQKESGKAPKPKPRARSAPNASAKQGFKTAPSRAPKDAYLGKAKKIKTDLIQRAKVKKQYAKVLRAEGMESERLGDGSRRRNEREESDNKLKGKTGSFKGKERREREERGEEDPDTARIRARAGPSSSSSSFSRPNKPFNKSYNNKPYDKTTRKSRVEEAPPKPKVRALSPSPPPSAPSSEPKPSLRTLKKEGFSKYHRAKDATGLSKGRGQPNMGARMGVLLEKIKRM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.86
3 0.88
4 0.87
5 0.85
6 0.84
7 0.84
8 0.8
9 0.82
10 0.8
11 0.79
12 0.8
13 0.75
14 0.69
15 0.65
16 0.6
17 0.51
18 0.47
19 0.37
20 0.34
21 0.36
22 0.38
23 0.39
24 0.46
25 0.48
26 0.47
27 0.5
28 0.46
29 0.46
30 0.46
31 0.43
32 0.46
33 0.44
34 0.46
35 0.49
36 0.49
37 0.48
38 0.46
39 0.46
40 0.43
41 0.51
42 0.55
43 0.58
44 0.66
45 0.66
46 0.7
47 0.72
48 0.71
49 0.68
50 0.65
51 0.62
52 0.64
53 0.66
54 0.66
55 0.63
56 0.61
57 0.56
58 0.5
59 0.44
60 0.35
61 0.29
62 0.22
63 0.17
64 0.14
65 0.11
66 0.11
67 0.11
68 0.12
69 0.15
70 0.23
71 0.3
72 0.34
73 0.37
74 0.41
75 0.45
76 0.47
77 0.51
78 0.47
79 0.5
80 0.53
81 0.55
82 0.51
83 0.48
84 0.44
85 0.37
86 0.35
87 0.33
88 0.32
89 0.37
90 0.39
91 0.46
92 0.53
93 0.6
94 0.65
95 0.64
96 0.66
97 0.63
98 0.65
99 0.64
100 0.64
101 0.57
102 0.52
103 0.5
104 0.42
105 0.36
106 0.31
107 0.27
108 0.19
109 0.17
110 0.13
111 0.11
112 0.12
113 0.14
114 0.16
115 0.18
116 0.18
117 0.2
118 0.22
119 0.27
120 0.26
121 0.26
122 0.25
123 0.23
124 0.29
125 0.31
126 0.38
127 0.36
128 0.45
129 0.49
130 0.53
131 0.58
132 0.58
133 0.64
134 0.6
135 0.67
136 0.68
137 0.67
138 0.64
139 0.6
140 0.61
141 0.61
142 0.63
143 0.59
144 0.59
145 0.63
146 0.67
147 0.69
148 0.66
149 0.64
150 0.67
151 0.71
152 0.69
153 0.69
154 0.69
155 0.67
156 0.62
157 0.56
158 0.49
159 0.44
160 0.44
161 0.41
162 0.45
163 0.51
164 0.55
165 0.55
166 0.52
167 0.49
168 0.44
169 0.43
170 0.37
171 0.36
172 0.36
173 0.4
174 0.44
175 0.45
176 0.45
177 0.45
178 0.52
179 0.52
180 0.53
181 0.55
182 0.59
183 0.62
184 0.65
185 0.65
186 0.64
187 0.62
188 0.65
189 0.66
190 0.66
191 0.65
192 0.62
193 0.58
194 0.58
195 0.62
196 0.57
197 0.54
198 0.48
199 0.45
200 0.49
201 0.52
202 0.5
203 0.44
204 0.4
205 0.4
206 0.46
207 0.51
208 0.44
209 0.39
210 0.32
211 0.31
212 0.29
213 0.23
214 0.17
215 0.15