Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G2FW83

Protein Details
Accession A0A0G2FW83    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
328-347GNKQLKKASQRKFSQARVTFHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 9.5, cyto 9, nucl 8, mito 5, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000727  T_SNARE_dom  
PROSITE View protein in PROSITE  
PS50192  T_SNARE  
CDD cd15850  SNARE_syntaxin18  
Amino Acid Sequences MEVTVTFNELLKARSASTTRGALPDLDRIDSYLKEASSINRDIVNLHSELSLIRQAYLSTAAPRKTQLRKGTQDTKSIYLTDADRNAVDKMAKESLQRLNLRIRILEDEEAKRHDAAMKEINRKYGRGLRALTGWAAGSALGQDEDGAKSPEHAAAIRLEMQLFVHKGTVIGYLKEKLNATTKLQGGMMETRLAREMEKNRSILAKARSSQLPPALAKEFGFDDPSAGSPSAPRSSAPGLPVDEEESRRRQEDDLGLTDEQRQMFERDNQDMLKHYNTALDKVKTVEKSIMEIAELQQMLADNLTVQSAHIDQLVTDAERTEENVGGGNKQLKKASQRKFSQARVTFYAASALCTVLVLWDLII
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.24
3 0.25
4 0.29
5 0.32
6 0.31
7 0.31
8 0.31
9 0.28
10 0.28
11 0.32
12 0.29
13 0.26
14 0.24
15 0.24
16 0.25
17 0.23
18 0.23
19 0.2
20 0.18
21 0.17
22 0.19
23 0.21
24 0.25
25 0.27
26 0.25
27 0.24
28 0.24
29 0.24
30 0.25
31 0.24
32 0.18
33 0.17
34 0.15
35 0.14
36 0.14
37 0.15
38 0.16
39 0.13
40 0.13
41 0.12
42 0.12
43 0.14
44 0.16
45 0.15
46 0.17
47 0.23
48 0.24
49 0.25
50 0.3
51 0.36
52 0.42
53 0.49
54 0.52
55 0.56
56 0.62
57 0.69
58 0.76
59 0.72
60 0.72
61 0.67
62 0.61
63 0.53
64 0.46
65 0.38
66 0.31
67 0.28
68 0.25
69 0.23
70 0.2
71 0.19
72 0.2
73 0.19
74 0.19
75 0.17
76 0.14
77 0.16
78 0.18
79 0.2
80 0.2
81 0.25
82 0.28
83 0.35
84 0.36
85 0.35
86 0.39
87 0.41
88 0.41
89 0.37
90 0.33
91 0.28
92 0.29
93 0.29
94 0.27
95 0.26
96 0.27
97 0.29
98 0.28
99 0.24
100 0.22
101 0.22
102 0.18
103 0.2
104 0.26
105 0.31
106 0.38
107 0.4
108 0.47
109 0.45
110 0.44
111 0.45
112 0.44
113 0.4
114 0.36
115 0.37
116 0.3
117 0.31
118 0.31
119 0.26
120 0.19
121 0.16
122 0.1
123 0.08
124 0.07
125 0.05
126 0.04
127 0.04
128 0.03
129 0.03
130 0.03
131 0.04
132 0.05
133 0.06
134 0.07
135 0.07
136 0.08
137 0.08
138 0.09
139 0.09
140 0.09
141 0.09
142 0.08
143 0.1
144 0.11
145 0.11
146 0.1
147 0.09
148 0.09
149 0.1
150 0.1
151 0.09
152 0.07
153 0.07
154 0.07
155 0.08
156 0.12
157 0.1
158 0.11
159 0.12
160 0.14
161 0.14
162 0.16
163 0.16
164 0.13
165 0.18
166 0.19
167 0.2
168 0.23
169 0.23
170 0.22
171 0.21
172 0.2
173 0.16
174 0.16
175 0.14
176 0.11
177 0.11
178 0.1
179 0.11
180 0.11
181 0.1
182 0.14
183 0.19
184 0.24
185 0.28
186 0.28
187 0.27
188 0.29
189 0.29
190 0.29
191 0.29
192 0.27
193 0.25
194 0.28
195 0.29
196 0.29
197 0.31
198 0.28
199 0.27
200 0.22
201 0.24
202 0.22
203 0.21
204 0.19
205 0.17
206 0.16
207 0.13
208 0.15
209 0.11
210 0.1
211 0.1
212 0.11
213 0.11
214 0.1
215 0.09
216 0.08
217 0.12
218 0.13
219 0.13
220 0.12
221 0.14
222 0.17
223 0.19
224 0.19
225 0.19
226 0.18
227 0.19
228 0.19
229 0.18
230 0.18
231 0.19
232 0.21
233 0.23
234 0.24
235 0.24
236 0.25
237 0.23
238 0.26
239 0.28
240 0.29
241 0.28
242 0.29
243 0.28
244 0.28
245 0.29
246 0.27
247 0.22
248 0.18
249 0.17
250 0.15
251 0.19
252 0.24
253 0.27
254 0.27
255 0.3
256 0.29
257 0.29
258 0.29
259 0.29
260 0.24
261 0.21
262 0.18
263 0.21
264 0.21
265 0.25
266 0.28
267 0.27
268 0.26
269 0.27
270 0.33
271 0.29
272 0.3
273 0.3
274 0.24
275 0.26
276 0.27
277 0.24
278 0.19
279 0.19
280 0.18
281 0.18
282 0.17
283 0.14
284 0.12
285 0.12
286 0.12
287 0.11
288 0.1
289 0.05
290 0.05
291 0.06
292 0.05
293 0.05
294 0.07
295 0.07
296 0.08
297 0.09
298 0.08
299 0.08
300 0.1
301 0.12
302 0.11
303 0.1
304 0.1
305 0.1
306 0.1
307 0.12
308 0.12
309 0.12
310 0.11
311 0.16
312 0.16
313 0.16
314 0.2
315 0.26
316 0.27
317 0.3
318 0.33
319 0.34
320 0.44
321 0.53
322 0.59
323 0.61
324 0.65
325 0.72
326 0.77
327 0.8
328 0.8
329 0.77
330 0.74
331 0.69
332 0.67
333 0.57
334 0.49
335 0.47
336 0.36
337 0.31
338 0.26
339 0.21
340 0.15
341 0.14
342 0.14
343 0.08
344 0.09