Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G2HCZ5

Protein Details
Accession A0A0G2HCZ5   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
97-117ESKSVCCLWRGNRRGKERKRLHydrophilic
NLS Segment(s)
PositionSequence
108-117NRRGKERKRL
Subcellular Location(s) cysk 9, nucl 8.5, cyto_nucl 7.5, cyto 5.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR018574  Structure-sp_endonuc_su_Slx4  
Gene Ontology GO:0033557  C:Slx1-Slx4 complex  
GO:0004519  F:endonuclease activity  
GO:0006310  P:DNA recombination  
GO:0006281  P:DNA repair  
GO:0006260  P:DNA replication  
GO:0006996  P:organelle organization  
Pfam View protein in Pfam  
PF09494  Slx4  
Amino Acid Sequences MILTSPGGGAVDINEDTEISLHLSPTAQQSALFSHITRAVTSAPRTTDPENPSWHEKMLMYDPVILEDLTAWLNEGQLTRVGYDGEASPTDVKKWCESKSVCCLWRGNRRGKERKRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.08
5 0.08
6 0.08
7 0.08
8 0.08
9 0.08
10 0.08
11 0.1
12 0.13
13 0.14
14 0.12
15 0.11
16 0.12
17 0.14
18 0.16
19 0.16
20 0.13
21 0.13
22 0.16
23 0.16
24 0.15
25 0.15
26 0.14
27 0.17
28 0.18
29 0.19
30 0.18
31 0.19
32 0.22
33 0.24
34 0.28
35 0.28
36 0.3
37 0.31
38 0.32
39 0.35
40 0.33
41 0.31
42 0.25
43 0.22
44 0.2
45 0.19
46 0.17
47 0.12
48 0.13
49 0.12
50 0.12
51 0.12
52 0.1
53 0.07
54 0.06
55 0.06
56 0.05
57 0.05
58 0.05
59 0.04
60 0.05
61 0.06
62 0.06
63 0.06
64 0.08
65 0.09
66 0.08
67 0.09
68 0.09
69 0.08
70 0.09
71 0.09
72 0.09
73 0.09
74 0.1
75 0.12
76 0.13
77 0.15
78 0.18
79 0.2
80 0.25
81 0.3
82 0.3
83 0.37
84 0.4
85 0.44
86 0.49
87 0.55
88 0.51
89 0.5
90 0.54
91 0.54
92 0.62
93 0.63
94 0.65
95 0.66
96 0.74
97 0.81