Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G2FPA1

Protein Details
Accession A0A0G2FPA1    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MSSSQERQPRRQKKQQQVVEESESHydrophilic
28-54SEEQYEPPKRSNRRSRQQNNQMQQRQQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MSSSQERQPRRQKKQQQVVEESESDSGSEEQYEPPKRSNRRSRQQNNQMQQRQQQGPMNQMGGGMPGTMGNVANQAMQQQQQQPQGGGGGKSDTLRLRLDLNLDIEITLKAKIHGDLELALLHTCLLITTL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.9
3 0.88
4 0.84
5 0.8
6 0.74
7 0.64
8 0.54
9 0.44
10 0.36
11 0.26
12 0.21
13 0.15
14 0.1
15 0.1
16 0.1
17 0.12
18 0.19
19 0.25
20 0.25
21 0.3
22 0.39
23 0.45
24 0.54
25 0.63
26 0.66
27 0.71
28 0.81
29 0.84
30 0.87
31 0.91
32 0.9
33 0.88
34 0.88
35 0.83
36 0.76
37 0.73
38 0.69
39 0.6
40 0.54
41 0.5
42 0.41
43 0.39
44 0.36
45 0.31
46 0.23
47 0.21
48 0.16
49 0.12
50 0.1
51 0.06
52 0.04
53 0.03
54 0.03
55 0.04
56 0.04
57 0.03
58 0.04
59 0.04
60 0.05
61 0.05
62 0.06
63 0.07
64 0.08
65 0.11
66 0.14
67 0.19
68 0.23
69 0.24
70 0.23
71 0.22
72 0.23
73 0.22
74 0.18
75 0.14
76 0.11
77 0.11
78 0.11
79 0.13
80 0.12
81 0.13
82 0.14
83 0.15
84 0.15
85 0.16
86 0.18
87 0.18
88 0.18
89 0.17
90 0.16
91 0.15
92 0.14
93 0.13
94 0.11
95 0.1
96 0.08
97 0.09
98 0.1
99 0.12
100 0.12
101 0.12
102 0.13
103 0.13
104 0.13
105 0.13
106 0.12
107 0.11
108 0.1
109 0.09
110 0.07
111 0.07