Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G2I240

Protein Details
Accession A0A0G2I240   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
11-40GGALRIKGAKVKKHKKKKDKSALEKNLTEPBasic
NLS Segment(s)
PositionSequence
14-32LRIKGAKVKKHKKKKDKSA
Subcellular Location(s) nucl 17, cyto_nucl 10.5, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MPSEEYKSAGGGALRIKGAKVKKHKKKKDKSALEKNLTEPKKDEEAQDKEEPEEDEPTRSHKTEAERRFEEARRKRLLEKAETSRPELLKTHKERVEELNTYLSKLSEHHDMPKIGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.16
4 0.21
5 0.26
6 0.33
7 0.42
8 0.5
9 0.6
10 0.71
11 0.82
12 0.87
13 0.92
14 0.94
15 0.94
16 0.95
17 0.94
18 0.95
19 0.94
20 0.89
21 0.8
22 0.73
23 0.71
24 0.61
25 0.52
26 0.43
27 0.37
28 0.35
29 0.34
30 0.33
31 0.32
32 0.36
33 0.4
34 0.41
35 0.37
36 0.32
37 0.32
38 0.3
39 0.22
40 0.21
41 0.16
42 0.15
43 0.14
44 0.18
45 0.19
46 0.19
47 0.18
48 0.18
49 0.25
50 0.32
51 0.38
52 0.41
53 0.4
54 0.43
55 0.47
56 0.49
57 0.52
58 0.51
59 0.53
60 0.51
61 0.52
62 0.53
63 0.54
64 0.55
65 0.52
66 0.51
67 0.51
68 0.53
69 0.53
70 0.53
71 0.52
72 0.46
73 0.42
74 0.38
75 0.37
76 0.38
77 0.43
78 0.48
79 0.46
80 0.47
81 0.48
82 0.51
83 0.53
84 0.45
85 0.41
86 0.4
87 0.37
88 0.36
89 0.34
90 0.27
91 0.2
92 0.19
93 0.2
94 0.19
95 0.21
96 0.27
97 0.32
98 0.34