Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G2HQI6

Protein Details
Accession A0A0G2HQI6   
Localization Confidence High
Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MPKAAAKRAPKATRRAKKDPNAPKRGLHydrophilic
NLS Segment(s)
PositionSequence
4-25AAAKRAPKATRRAKKDPNAPKR
Subcellular Location(s) nucl 21, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKAAAKRAPKATRRAKKDPNAPKRGLSAYMFFANEQRENVREENPGITFGQVGKLLGERWKALNEKQRAPYEAKAAADKKRYEDEKQAYNELIRPRLQAEEEEEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.83
3 0.82
4 0.82
5 0.86
6 0.87
7 0.87
8 0.85
9 0.79
10 0.72
11 0.66
12 0.59
13 0.52
14 0.43
15 0.34
16 0.29
17 0.28
18 0.26
19 0.21
20 0.21
21 0.21
22 0.19
23 0.18
24 0.17
25 0.15
26 0.18
27 0.2
28 0.19
29 0.18
30 0.18
31 0.18
32 0.17
33 0.17
34 0.14
35 0.12
36 0.1
37 0.09
38 0.09
39 0.08
40 0.07
41 0.06
42 0.06
43 0.07
44 0.09
45 0.1
46 0.1
47 0.11
48 0.14
49 0.16
50 0.21
51 0.29
52 0.32
53 0.37
54 0.42
55 0.45
56 0.44
57 0.46
58 0.44
59 0.4
60 0.38
61 0.33
62 0.32
63 0.33
64 0.36
65 0.38
66 0.37
67 0.37
68 0.42
69 0.45
70 0.43
71 0.49
72 0.49
73 0.51
74 0.53
75 0.52
76 0.46
77 0.43
78 0.44
79 0.39
80 0.38
81 0.31
82 0.29
83 0.28
84 0.3
85 0.3
86 0.28