Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G2HXW8

Protein Details
Accession A0A0G2HXW8   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
65-87ARLKAKKKSSAAKKSRRKHRDGABasic
NLS Segment(s)
PositionSequence
66-87RLKAKKKSSAAKKSRRKHRDGA
Subcellular Location(s) nucl 13.5, cyto_nucl 11, mito 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR000352  Pep_chain_release_fac_I  
IPR045853  Pep_chain_release_fac_I_sf  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0016787  F:hydrolase activity  
GO:0003747  F:translation release factor activity  
Pfam View protein in Pfam  
PF00472  RF-1  
Amino Acid Sequences MSLQRYTSRNKTNSAVQLRHIPTGIVVKCQDTRSREQNRKLAREHLAEKIDDLLNGDQSRSAVVARLKAKKKSSAAKKSRRKHRDGAGGREQGEEEDDDNGTLGLDGVDGEPLHDDTPKKTIKVQEIRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.56
3 0.49
4 0.55
5 0.53
6 0.51
7 0.43
8 0.33
9 0.26
10 0.32
11 0.29
12 0.24
13 0.22
14 0.23
15 0.27
16 0.29
17 0.33
18 0.3
19 0.36
20 0.42
21 0.52
22 0.58
23 0.62
24 0.68
25 0.7
26 0.71
27 0.67
28 0.64
29 0.59
30 0.56
31 0.51
32 0.49
33 0.42
34 0.36
35 0.33
36 0.29
37 0.24
38 0.18
39 0.17
40 0.11
41 0.12
42 0.12
43 0.12
44 0.09
45 0.09
46 0.09
47 0.08
48 0.07
49 0.07
50 0.08
51 0.14
52 0.18
53 0.26
54 0.3
55 0.35
56 0.38
57 0.41
58 0.46
59 0.5
60 0.56
61 0.59
62 0.66
63 0.71
64 0.79
65 0.82
66 0.88
67 0.87
68 0.83
69 0.8
70 0.78
71 0.78
72 0.75
73 0.74
74 0.72
75 0.68
76 0.62
77 0.55
78 0.46
79 0.35
80 0.29
81 0.22
82 0.13
83 0.1
84 0.09
85 0.08
86 0.08
87 0.08
88 0.07
89 0.06
90 0.05
91 0.04
92 0.03
93 0.04
94 0.04
95 0.05
96 0.05
97 0.06
98 0.07
99 0.08
100 0.09
101 0.12
102 0.13
103 0.14
104 0.22
105 0.26
106 0.26
107 0.31
108 0.38
109 0.45