Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G2I6G8

Protein Details
Accession A0A0G2I6G8   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
219-239ATNGKVKSNCASKKRRVRRHAHydrophilic
NLS Segment(s)
PositionSequence
231-239KKRRVRRHA
Subcellular Location(s) extr 22, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR018466  Kre9/Knh1-like_N  
Pfam View protein in Pfam  
PF10342  Kre9_KNH  
Amino Acid Sequences MRSLSLLALAAPLVSAIQFSNPTVNSTLTRGSTFDLQWSSVDTDPEAFSVYLVNFVNWPPYYAPVSFDVDATTGEASVRVPCDVDPSYGYQFNAINGTNVYIIYAQTPKFSIAGAACTDEQPPVTAAPTCAAPTATVTATVTVRGNSTLLVPTATPTATGAPLGHELVAKSKYEGECPEVIGWSGGYDSPVKLTEIPRAGSSGQSSAAQVGSEAGLTAATNGKVKSNCASKKRRVRRHA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.05
3 0.04
4 0.07
5 0.08
6 0.09
7 0.14
8 0.14
9 0.17
10 0.18
11 0.2
12 0.2
13 0.21
14 0.24
15 0.21
16 0.22
17 0.2
18 0.21
19 0.22
20 0.21
21 0.23
22 0.21
23 0.2
24 0.19
25 0.21
26 0.22
27 0.19
28 0.2
29 0.16
30 0.16
31 0.15
32 0.15
33 0.14
34 0.11
35 0.1
36 0.11
37 0.1
38 0.12
39 0.12
40 0.12
41 0.1
42 0.11
43 0.16
44 0.14
45 0.16
46 0.13
47 0.16
48 0.18
49 0.18
50 0.2
51 0.18
52 0.22
53 0.2
54 0.19
55 0.17
56 0.15
57 0.14
58 0.13
59 0.1
60 0.06
61 0.06
62 0.06
63 0.06
64 0.07
65 0.07
66 0.07
67 0.07
68 0.07
69 0.12
70 0.12
71 0.13
72 0.13
73 0.15
74 0.18
75 0.19
76 0.19
77 0.16
78 0.16
79 0.15
80 0.16
81 0.13
82 0.11
83 0.09
84 0.1
85 0.09
86 0.08
87 0.08
88 0.06
89 0.06
90 0.07
91 0.09
92 0.08
93 0.09
94 0.1
95 0.1
96 0.1
97 0.09
98 0.09
99 0.07
100 0.09
101 0.08
102 0.09
103 0.09
104 0.09
105 0.1
106 0.08
107 0.08
108 0.07
109 0.07
110 0.06
111 0.06
112 0.06
113 0.06
114 0.07
115 0.07
116 0.07
117 0.07
118 0.07
119 0.06
120 0.06
121 0.08
122 0.07
123 0.07
124 0.07
125 0.08
126 0.08
127 0.09
128 0.09
129 0.08
130 0.08
131 0.08
132 0.08
133 0.07
134 0.08
135 0.07
136 0.07
137 0.07
138 0.07
139 0.07
140 0.08
141 0.08
142 0.07
143 0.07
144 0.07
145 0.07
146 0.08
147 0.07
148 0.08
149 0.09
150 0.09
151 0.09
152 0.08
153 0.08
154 0.12
155 0.13
156 0.12
157 0.12
158 0.16
159 0.16
160 0.19
161 0.21
162 0.21
163 0.2
164 0.22
165 0.22
166 0.17
167 0.17
168 0.14
169 0.12
170 0.08
171 0.08
172 0.06
173 0.07
174 0.08
175 0.08
176 0.09
177 0.1
178 0.11
179 0.14
180 0.15
181 0.21
182 0.23
183 0.25
184 0.24
185 0.25
186 0.24
187 0.24
188 0.24
189 0.18
190 0.17
191 0.16
192 0.16
193 0.14
194 0.14
195 0.12
196 0.1
197 0.09
198 0.08
199 0.07
200 0.06
201 0.05
202 0.05
203 0.05
204 0.06
205 0.08
206 0.09
207 0.12
208 0.13
209 0.19
210 0.2
211 0.23
212 0.29
213 0.36
214 0.44
215 0.51
216 0.61
217 0.66
218 0.76
219 0.84