Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G2FZZ7

Protein Details
Accession A0A0G2FZZ7   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
182-207QDLEIQVRRARKKRAKERAAAARQQQHydrophilic
NLS Segment(s)
PositionSequence
189-200RRARKKRAKERA
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR040357  Vma22/CCDC115  
Gene Ontology GO:0070072  P:vacuolar proton-transporting V-type ATPase complex assembly  
Amino Acid Sequences MDPDTIDALLERYLALLDEYATLRARLSQLQTGMFQHLARANFSAERGMRYGPDFYDERMQALRQVSISTEAGLPIFTVSHSSRAGGVDDDSRQIPPPDPPRPAEEEGGEAAAAEGAPPSEPVPATDDKAESEAGPKKQNARDPLRWFGVLTPLSLRQTQACAAEAVDQVIPRLASVSAEMQDLEIQVRRARKKRAKERAAAARQQQQQQRQQQAVAGEELASR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.06
4 0.06
5 0.08
6 0.09
7 0.11
8 0.12
9 0.12
10 0.12
11 0.14
12 0.15
13 0.17
14 0.21
15 0.23
16 0.25
17 0.26
18 0.28
19 0.28
20 0.29
21 0.26
22 0.22
23 0.2
24 0.22
25 0.21
26 0.21
27 0.2
28 0.19
29 0.18
30 0.19
31 0.22
32 0.18
33 0.2
34 0.2
35 0.19
36 0.19
37 0.19
38 0.21
39 0.15
40 0.18
41 0.17
42 0.18
43 0.24
44 0.23
45 0.22
46 0.22
47 0.22
48 0.22
49 0.22
50 0.21
51 0.14
52 0.15
53 0.14
54 0.15
55 0.15
56 0.12
57 0.11
58 0.1
59 0.1
60 0.09
61 0.08
62 0.05
63 0.05
64 0.04
65 0.08
66 0.08
67 0.11
68 0.11
69 0.12
70 0.13
71 0.13
72 0.14
73 0.11
74 0.11
75 0.1
76 0.11
77 0.12
78 0.11
79 0.11
80 0.11
81 0.12
82 0.12
83 0.16
84 0.23
85 0.27
86 0.29
87 0.3
88 0.33
89 0.38
90 0.39
91 0.34
92 0.27
93 0.23
94 0.2
95 0.19
96 0.15
97 0.09
98 0.06
99 0.05
100 0.04
101 0.03
102 0.02
103 0.02
104 0.02
105 0.03
106 0.03
107 0.04
108 0.04
109 0.05
110 0.09
111 0.1
112 0.11
113 0.12
114 0.12
115 0.12
116 0.13
117 0.13
118 0.09
119 0.13
120 0.17
121 0.19
122 0.22
123 0.23
124 0.29
125 0.33
126 0.38
127 0.42
128 0.45
129 0.51
130 0.53
131 0.57
132 0.53
133 0.49
134 0.44
135 0.36
136 0.35
137 0.26
138 0.21
139 0.18
140 0.18
141 0.2
142 0.2
143 0.2
144 0.14
145 0.16
146 0.17
147 0.16
148 0.14
149 0.13
150 0.13
151 0.15
152 0.14
153 0.14
154 0.13
155 0.11
156 0.1
157 0.11
158 0.11
159 0.07
160 0.08
161 0.07
162 0.06
163 0.08
164 0.1
165 0.1
166 0.1
167 0.11
168 0.1
169 0.1
170 0.1
171 0.11
172 0.11
173 0.12
174 0.15
175 0.23
176 0.31
177 0.38
178 0.49
179 0.56
180 0.65
181 0.75
182 0.83
183 0.85
184 0.84
185 0.87
186 0.87
187 0.87
188 0.83
189 0.79
190 0.77
191 0.74
192 0.74
193 0.72
194 0.7
195 0.7
196 0.72
197 0.74
198 0.68
199 0.63
200 0.58
201 0.53
202 0.46
203 0.38
204 0.29