Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F9Z7G1

Protein Details
Accession A0A0F9Z7G1    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
216-237YAVAVSKKRKVRKFVCLKSWVYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto 7, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
Amino Acid Sequences MATFNSLDISNIVSLSIFKQFEEALKTRHNNIIVISGPSGSLKTSLINTVLNKLSLVSEYITDVSVYKSKLLTKSSICLTDIDDLEYFIKHKHKINKMSNLIIETRLLPYMYKSLDNGIGINLSISNKNKKDKINYHLSPYKKLRSIEPLPCIYKTLNILFSNQSYKVTICYDYKILKYIFSNSLEFIELESLYNIYDSISLADLKLDEFIDYAVYAVAVSKKRKVRKFVCLKSWVYENHYVCTPLCFEYKKYF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.16
4 0.14
5 0.14
6 0.15
7 0.16
8 0.19
9 0.26
10 0.27
11 0.25
12 0.34
13 0.37
14 0.39
15 0.44
16 0.42
17 0.36
18 0.34
19 0.34
20 0.27
21 0.26
22 0.23
23 0.18
24 0.16
25 0.16
26 0.15
27 0.1
28 0.1
29 0.08
30 0.09
31 0.1
32 0.12
33 0.13
34 0.16
35 0.17
36 0.21
37 0.21
38 0.2
39 0.19
40 0.17
41 0.16
42 0.13
43 0.13
44 0.09
45 0.08
46 0.09
47 0.1
48 0.1
49 0.09
50 0.09
51 0.1
52 0.12
53 0.12
54 0.13
55 0.14
56 0.18
57 0.21
58 0.24
59 0.26
60 0.25
61 0.28
62 0.3
63 0.3
64 0.27
65 0.24
66 0.23
67 0.22
68 0.21
69 0.19
70 0.16
71 0.14
72 0.14
73 0.14
74 0.12
75 0.11
76 0.15
77 0.16
78 0.23
79 0.31
80 0.39
81 0.49
82 0.57
83 0.64
84 0.64
85 0.64
86 0.59
87 0.52
88 0.45
89 0.35
90 0.27
91 0.18
92 0.14
93 0.12
94 0.1
95 0.08
96 0.08
97 0.1
98 0.11
99 0.11
100 0.1
101 0.11
102 0.12
103 0.12
104 0.11
105 0.09
106 0.08
107 0.07
108 0.07
109 0.06
110 0.05
111 0.08
112 0.1
113 0.16
114 0.19
115 0.23
116 0.28
117 0.31
118 0.39
119 0.44
120 0.48
121 0.52
122 0.51
123 0.54
124 0.55
125 0.53
126 0.52
127 0.49
128 0.48
129 0.43
130 0.42
131 0.37
132 0.4
133 0.45
134 0.44
135 0.44
136 0.44
137 0.41
138 0.4
139 0.39
140 0.31
141 0.26
142 0.23
143 0.2
144 0.21
145 0.2
146 0.21
147 0.21
148 0.23
149 0.24
150 0.21
151 0.2
152 0.15
153 0.15
154 0.15
155 0.16
156 0.17
157 0.15
158 0.17
159 0.2
160 0.21
161 0.22
162 0.24
163 0.23
164 0.22
165 0.22
166 0.24
167 0.25
168 0.25
169 0.26
170 0.22
171 0.23
172 0.21
173 0.2
174 0.15
175 0.12
176 0.1
177 0.09
178 0.09
179 0.08
180 0.07
181 0.07
182 0.06
183 0.05
184 0.05
185 0.05
186 0.06
187 0.07
188 0.07
189 0.07
190 0.07
191 0.07
192 0.07
193 0.08
194 0.07
195 0.07
196 0.07
197 0.07
198 0.07
199 0.07
200 0.06
201 0.05
202 0.05
203 0.04
204 0.06
205 0.11
206 0.16
207 0.19
208 0.27
209 0.35
210 0.44
211 0.52
212 0.61
213 0.64
214 0.7
215 0.78
216 0.81
217 0.83
218 0.81
219 0.77
220 0.7
221 0.68
222 0.61
223 0.57
224 0.56
225 0.48
226 0.43
227 0.42
228 0.4
229 0.34
230 0.33
231 0.28
232 0.22
233 0.26
234 0.25