Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q5KDL6

Protein Details
Accession Q5KDL6    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
7-33HTAHNQTRKAHRNKIQRPKTNKYHSLKHydrophilic
NLS Segment(s)
PositionSequence
14-41RKAHRNKIQRPKTNKYHSLKGVDPKFRR
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0002181  P:cytoplasmic translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTAHNQTRKAHRNKIQRPKTNKYHSLKGVDPKFRRNARYAAQGSAKAIREAKASA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.78
3 0.78
4 0.76
5 0.77
6 0.79
7 0.85
8 0.86
9 0.85
10 0.85
11 0.84
12 0.86
13 0.84
14 0.83
15 0.77
16 0.74
17 0.68
18 0.64
19 0.58
20 0.57
21 0.55
22 0.54
23 0.52
24 0.51
25 0.55
26 0.56
27 0.57
28 0.52
29 0.51
30 0.47
31 0.54
32 0.5
33 0.47
34 0.45
35 0.43
36 0.41
37 0.41
38 0.38
39 0.31
40 0.31
41 0.27