Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F9YMZ4

Protein Details
Accession A0A0F9YMZ4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MKHYSLLKKKYKYRRFKSALIGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MKHYSLLKKKYKYRRFKSALIGVLWTTKKGNNYLCGPDGFKYSPLHNLTTPPFLSKPLRTLHQDSNLLKLIY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.83
3 0.81
4 0.8
5 0.76
6 0.7
7 0.6
8 0.52
9 0.41
10 0.4
11 0.34
12 0.26
13 0.19
14 0.17
15 0.18
16 0.21
17 0.23
18 0.22
19 0.25
20 0.26
21 0.27
22 0.26
23 0.25
24 0.21
25 0.21
26 0.18
27 0.17
28 0.16
29 0.15
30 0.22
31 0.23
32 0.25
33 0.22
34 0.25
35 0.25
36 0.28
37 0.28
38 0.24
39 0.22
40 0.24
41 0.29
42 0.27
43 0.3
44 0.3
45 0.35
46 0.38
47 0.43
48 0.47
49 0.5
50 0.56
51 0.52
52 0.54