Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F9WQK9

Protein Details
Accession A0A0F9WQK9    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
283-302MEEIKKKNKNLEEKLKKYVKBasic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 11.5, cyto 8.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR032396  SAS-6_N  
IPR038558  SAS-6_N_sf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0043232  C:intracellular non-membrane-bounded organelle  
Pfam View protein in Pfam  
PF16531  SAS-6_N  
Amino Acid Sequences MKEILFTGKIQIYSYDEQIPTKMKCDVLQELDTLTIKLINSTDVFSFYICTISSDDFYILKREQDLIVDYHKFIEIVIKLFHKIQNNLLFAYFVDLKFMFVEKNEFRNIIKLELKFKEPSDIDYKSYLGDVISRLETDNIKLIKENNLLKDYNNNTLHRKLRNLEENQNIHISKLNNLNKQNEEYKYKIEKMTNEIKSLNNQVYELEKENIKLKVDKEKSNKLQEEYLEIKNINENIRKDLETANEIIKKIRTENLDYKNKLEEIENNIKNRQNEIERYEKNMEEIKKKNKNLEEKLKKYVKDNKEYKIKVKDLENEKTNLVRKLENAQSVFNHFSNNREIRDKYSSDSISGYSIQPEEKPE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.31
3 0.29
4 0.29
5 0.31
6 0.35
7 0.3
8 0.3
9 0.31
10 0.26
11 0.28
12 0.33
13 0.36
14 0.36
15 0.36
16 0.34
17 0.31
18 0.32
19 0.3
20 0.24
21 0.17
22 0.14
23 0.12
24 0.13
25 0.13
26 0.12
27 0.13
28 0.14
29 0.15
30 0.15
31 0.15
32 0.14
33 0.15
34 0.12
35 0.13
36 0.11
37 0.12
38 0.12
39 0.13
40 0.14
41 0.14
42 0.15
43 0.15
44 0.16
45 0.19
46 0.18
47 0.18
48 0.18
49 0.19
50 0.18
51 0.19
52 0.2
53 0.18
54 0.22
55 0.23
56 0.22
57 0.21
58 0.2
59 0.18
60 0.16
61 0.19
62 0.15
63 0.15
64 0.18
65 0.18
66 0.19
67 0.23
68 0.27
69 0.27
70 0.27
71 0.32
72 0.37
73 0.37
74 0.37
75 0.34
76 0.3
77 0.24
78 0.26
79 0.21
80 0.13
81 0.15
82 0.14
83 0.14
84 0.15
85 0.15
86 0.11
87 0.1
88 0.17
89 0.17
90 0.2
91 0.22
92 0.22
93 0.22
94 0.28
95 0.28
96 0.27
97 0.29
98 0.28
99 0.33
100 0.34
101 0.37
102 0.34
103 0.33
104 0.34
105 0.29
106 0.31
107 0.3
108 0.3
109 0.29
110 0.28
111 0.28
112 0.21
113 0.21
114 0.17
115 0.1
116 0.1
117 0.08
118 0.09
119 0.09
120 0.09
121 0.09
122 0.11
123 0.11
124 0.11
125 0.15
126 0.14
127 0.14
128 0.15
129 0.16
130 0.2
131 0.25
132 0.28
133 0.26
134 0.28
135 0.29
136 0.28
137 0.34
138 0.31
139 0.34
140 0.35
141 0.34
142 0.34
143 0.4
144 0.45
145 0.4
146 0.42
147 0.36
148 0.38
149 0.44
150 0.45
151 0.46
152 0.49
153 0.48
154 0.45
155 0.46
156 0.4
157 0.31
158 0.3
159 0.23
160 0.19
161 0.26
162 0.3
163 0.33
164 0.36
165 0.39
166 0.37
167 0.39
168 0.41
169 0.34
170 0.33
171 0.29
172 0.32
173 0.33
174 0.34
175 0.34
176 0.32
177 0.31
178 0.32
179 0.4
180 0.36
181 0.34
182 0.33
183 0.3
184 0.31
185 0.32
186 0.28
187 0.19
188 0.17
189 0.16
190 0.16
191 0.17
192 0.17
193 0.15
194 0.14
195 0.14
196 0.18
197 0.19
198 0.18
199 0.2
200 0.19
201 0.28
202 0.32
203 0.39
204 0.43
205 0.51
206 0.56
207 0.62
208 0.64
209 0.55
210 0.54
211 0.46
212 0.46
213 0.4
214 0.34
215 0.27
216 0.24
217 0.22
218 0.22
219 0.24
220 0.22
221 0.23
222 0.23
223 0.24
224 0.27
225 0.27
226 0.26
227 0.26
228 0.24
229 0.21
230 0.21
231 0.22
232 0.22
233 0.22
234 0.22
235 0.22
236 0.21
237 0.21
238 0.24
239 0.23
240 0.28
241 0.36
242 0.44
243 0.51
244 0.51
245 0.51
246 0.5
247 0.47
248 0.41
249 0.34
250 0.29
251 0.29
252 0.38
253 0.4
254 0.39
255 0.43
256 0.46
257 0.45
258 0.43
259 0.4
260 0.36
261 0.37
262 0.39
263 0.45
264 0.43
265 0.48
266 0.49
267 0.44
268 0.41
269 0.42
270 0.42
271 0.4
272 0.47
273 0.51
274 0.57
275 0.61
276 0.66
277 0.68
278 0.73
279 0.75
280 0.78
281 0.78
282 0.74
283 0.81
284 0.79
285 0.72
286 0.7
287 0.71
288 0.69
289 0.68
290 0.7
291 0.69
292 0.73
293 0.75
294 0.75
295 0.74
296 0.69
297 0.64
298 0.64
299 0.64
300 0.62
301 0.66
302 0.62
303 0.55
304 0.53
305 0.54
306 0.52
307 0.48
308 0.42
309 0.36
310 0.34
311 0.4
312 0.44
313 0.44
314 0.41
315 0.39
316 0.39
317 0.42
318 0.44
319 0.37
320 0.36
321 0.3
322 0.31
323 0.38
324 0.41
325 0.4
326 0.41
327 0.43
328 0.44
329 0.5
330 0.49
331 0.44
332 0.48
333 0.45
334 0.4
335 0.39
336 0.34
337 0.29
338 0.29
339 0.25
340 0.2
341 0.2
342 0.2