Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F9YSC5

Protein Details
Accession A0A0F9YSC5   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
9-42ADYCRIEKKEKTEKIKKSKRKYKKVKNNIVIPRVHydrophilic
NLS Segment(s)
PositionSequence
16-34KKEKTEKIKKSKRKYKKVK
Subcellular Location(s) nucl 17.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
Amino Acid Sequences MKKKIHPVADYCRIEKKEKTEKIKKSKRKYKKVKNNIVIPRVISNYKNPSNKIVSLEARQPLHDIEIINYNKFIEFNKFLDKIEEHCKNENKSLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.54
3 0.54
4 0.54
5 0.59
6 0.66
7 0.68
8 0.74
9 0.81
10 0.87
11 0.88
12 0.88
13 0.9
14 0.91
15 0.92
16 0.93
17 0.93
18 0.94
19 0.95
20 0.94
21 0.92
22 0.91
23 0.87
24 0.79
25 0.69
26 0.59
27 0.5
28 0.41
29 0.34
30 0.26
31 0.23
32 0.26
33 0.31
34 0.33
35 0.32
36 0.34
37 0.35
38 0.35
39 0.33
40 0.31
41 0.27
42 0.26
43 0.29
44 0.29
45 0.27
46 0.25
47 0.23
48 0.19
49 0.18
50 0.18
51 0.14
52 0.11
53 0.19
54 0.2
55 0.19
56 0.19
57 0.18
58 0.17
59 0.17
60 0.17
61 0.16
62 0.18
63 0.21
64 0.28
65 0.29
66 0.29
67 0.33
68 0.33
69 0.31
70 0.37
71 0.43
72 0.4
73 0.47
74 0.54
75 0.54